KEGG   Bacillus simplex: UP17_11305Help
Entry
UP17_11305        CDS       T04304                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsj  Bacillus simplex
Pathway
bsj00071  Fatty acid degradation
bsj00072  Synthesis and degradation of ketone bodies
bsj00280  Valine, leucine and isoleucine degradation
bsj00310  Lysine degradation
bsj00362  Benzoate degradation
bsj00380  Tryptophan metabolism
bsj00620  Pyruvate metabolism
bsj00630  Glyoxylate and dicarboxylate metabolism
bsj00640  Propanoate metabolism
bsj00650  Butanoate metabolism
bsj00900  Terpenoid backbone biosynthesis
bsj01100  Metabolic pathways
bsj01110  Biosynthesis of secondary metabolites
bsj01120  Microbial metabolism in diverse environments
bsj01130  Biosynthesis of antibiotics
bsj01200  Carbon metabolism
bsj01212  Fatty acid metabolism
bsj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    UP17_11305
   00630 Glyoxylate and dicarboxylate metabolism
    UP17_11305
   00640 Propanoate metabolism
    UP17_11305
   00650 Butanoate metabolism
    UP17_11305
  09103 Lipid metabolism
   00071 Fatty acid degradation
    UP17_11305
   00072 Synthesis and degradation of ketone bodies
    UP17_11305
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UP17_11305
   00310 Lysine degradation
    UP17_11305
   00380 Tryptophan metabolism
    UP17_11305
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    UP17_11305
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    UP17_11305
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    UP17_11305
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsj04147]
    UP17_11305
Enzymes [BR:bsj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     UP17_11305
Exosome [BR:bsj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UP17_11305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N
Motif
Other DBs
NCBI-ProteinID: AMM93031
UniProt: A0A127D7H4
Position
2425829..2426992
Genome map
AA seq 387 aa AA seqDB search
MSIKGLAYIAGAFEHSLRKAPNKSVAALHAECAKGALEDAGLAFADVDGYFCAGDAPGGV
LSMVDYLGLNVRHVDGTDTGGSSYIAHVSHAAQAIAAGKCNVALITMAGRPRTEGRSGVK
QKIVGANVPDTPFELPFGPTAVNEYAMATMRHMHEYGTTSEQLAWVKVAASHHARHNSNA
MLRDLVTVQDVLESPIIADPLHKLDCCVVSDGGGALVVVKPEIAKSLKRPLVRVMGCGEA
PKGLLDGKTDLTYTGAIWSGPRAFEEAGVTPQDIKYASIYDSFTITVLMQLEDLGFCEKG
EGGKFVADGNLISGVGKLPINTDGGGLNNNHPASRGGIIKVIEAVRQLRGEAHPQVQVEN
CDIALAHGTGGGIASRHGSATLIMERV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagtattaaaggattggcctatattgcaggggcgttcgagcactcactgcgtaaggct
ccgaataaatccgttgctgctttacatgcagaatgtgcgaaaggtgcattagaagatgct
ggactagcatttgcagatgtagacggatatttttgtgctggtgacgctccgggtggtgta
ctgtctatggtcgattatttaggtctcaatgtacgtcatgtagatggtacagacactggc
gggtcatcgtacattgcccatgtttcccatgctgcacaagcaatcgcagctggcaaatgt
aatgttgcattaattacaatggcgggtcgtccacgtacagagggcagaagtggtgtcaaa
cagaagatcgttggtgcaaatgttccagatacaccgtttgaacttccttttggaccgact
gctgtcaatgagtacgcgatggctacaatgcgtcatatgcatgaatatggtacgacgagt
gaacaattagcatgggtcaaagtcgcagcttcacatcatgccaggcataattcaaacgca
atgctgcgtgatttagtgacggttcaggacgtacttgagtcccctataattgctgatcca
ttacataaactggattgctgtgtagtaagtgacggtggaggtgctttagttgtcgtaaaa
cccgagattgccaaaagtctgaagcgtccacttgtccgagtgatgggttgtggggaagca
cctaaaggattacttgacggcaaaacggatcttacgtatacaggcgctatttggtcaggg
cctagagcctttgaggaggctggggttacacctcaagatattaagtatgcgtccatttat
gatagcttcacaattacggtgttaatgcagcttgaagacttaggtttttgtgaaaaaggc
gagggtggaaaattcgtcgctgatgggaacctgatttcaggagtaggtaagctcccaatc
aatacggatggtggcgggttaaataacaatcacccagcaagccgaggtggcatcattaaa
gtgatagaggctgtccgtcagctacgtggcgaagcacacccgcaagtgcaggtggaaaat
tgtgacatcgcgttagctcatggtactggtggcggaatagcaagccgtcacggtagtgca
acactgatcatggagagggtgtag

DBGET integrated database retrieval system