KEGG   Bacillus simplex: UP17_11410Help
Entry
UP17_11410        CDS       T04304                                 

Definition
(GenBank) hypothetical protein
  KO
K01449  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
bsj  Bacillus simplex
Brite
KEGG Orthology (KO) [BR:bsj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    UP17_11410
Enzymes [BR:bsj01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     UP17_11410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_2 PG_binding_1 WW
Motif
Other DBs
NCBI-ProteinID: AMM95495
UniProt: A0A127DEG1
Position
complement(2446303..2446902)
Genome map
AA seq 199 aa AA seqDB search
MSFVVFICFMFFIPNSIFAQEILHNGSQGQAVYDLQENLKKMGYFNRQPTGYYGAITDHA
VKQLQLDSGILPDGVFGFQTQQKLNSIEMMARVVYGEARGETYEGKVAVAAVILNRMSTP
GFPKNTYDVIFQTNAFTAVHDGQYYLTPNSYSYRAVIDALQGWDPTHGSVYYYNPFSATD
EWIFTRETVIRIGNHLFAK
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttgttgtttttatttgtttcatgttttttataccaaattcaatctttgctcaa
gaaattttacacaatggaagtcaaggacaagcagtttatgacttacaagaaaatttaaag
aaaatgggttactttaataggcaaccaacagggtattatggtgcaattactgatcatgca
gttaaacaacttcaactagattctggaatattaccagatggagtttttggattccaaaca
caacaaaaattaaatagtattgaaatgatggccagggttgtttatggagaagctcgagga
gaaacttatgaaggaaaagtagctgtcgctgcagtaattttgaaccgaatgtcaacgcca
ggttttcctaaaaatacttacgatgttattttccagacaaatgcttttacagctgtacat
gatgggcaatattatttgaccccaaatagctattcatatcgagctgttattgatgcatta
caaggttgggatcctactcatggttctgtttattattataatccgttctcggcaacagat
gaatggattttcacaagggaaacagtcattagaataggcaaccacttatttgcaaagtaa

DBGET integrated database retrieval system