KEGG   Bacillus simplex: UP17_12220Help
Entry
UP17_12220        CDS       T04304                                 

Definition
(GenBank) hydroxyglutarate oxidase
  KO
K15736  (S)-2-hydroxyglutarate dehydrogenase [EC:1.1.5.13]
Organism
bsj  Bacillus simplex
Pathway
bsj00310  Lysine degradation
bsj01100  Metabolic pathways
bsj01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    UP17_12220
Enzymes [BR:bsj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.13  (S)-2-hydroxyglutarate dehydrogenase
     UP17_12220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Pyr_redox_2 Pyr_redox_3 Mqo Pyr_redox Lycopene_cycl NAD_binding_8 FAD_binding_3 Thi4 Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AMM93184
UniProt: A0A127D834
Position
complement(2618911..2620128)
Genome map
AA seq 405 aa AA seqDB search
MYDFAIVGGGIVGLSTGMALYQRFPNAKVVVIEKEAVVADHQTGHNSGVIHSGIYYKPGS
FKARFARQGSKSMTEFCRMHGIEHDICGKVIVATKPEELPLLDDLYSRGLQNELAIQRIG
VDELKEIEPHVNGLGAIRVPQAGIVNYRQVSEKMADIIRGNGGEIMLNTKVEKIDENFDD
VIIETNNGTIKARIVINCAGLHSDRIAAAAGYKTDMKIVPFRGEYFKLKPEKRFLVNHLI
YPVPNPKFPFLGVHFTRMISGEVDAGPNAVLSFKREGYKKTDFNAKDLTEVLSYKGFWKL
ASKFMKEGMDEYVRSFSKKQFTKSLQELIPEIQEDDLIPAPSGVRAQALQDDGNMVDDFH
IIMGKRTIHVCNAPSPAATASIEIGKEVVNRIPEQSHLLEAVLTK
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
gtgtatgattttgcaattgttggtgggggaatagtaggtttatcaacgggaatggcactt
tatcagcgttttcctaatgctaaagtggtagtcattgaaaaagaggccgttgttgcagat
catcaaacggggcataacagcggcgtcatccattcaggaatttattataaaccaggcagt
ttcaaggcacggtttgcccgtcaaggaagcaaatcaatgacggaattctgccggatgcat
ggaattgaacatgatatttgcggaaaggtcattgttgcaacaaagccagaagagttgccc
cttttggatgatttatattcacgcggtttgcaaaatgagctagctatacaacgaatcggt
gtggacgagttaaaggaaatcgaaccacatgtcaatggacttggtgcgatacgcgtcccg
caagcaggcatcgtcaattatcgtcaggtaagtgaaaagatggcggatatcatccggggc
aacggcggtgaaatcatgctgaatacaaaggtggagaagattgacgagaattttgatgat
gtcatcatcgaaacgaacaatggtaccataaaggcaaggatagtcattaattgcgcaggg
ttgcacagtgaccgtatcgcagcagctgcggggtataaaactgatatgaaaattgtcccg
tttcgcggtgagtattttaaactgaagcccgaaaagcgcttccttgtcaatcatttaatt
tatccggtacctaacccgaaattcccatttttaggggttcatttcacacggatgattagc
ggggaagtagatgctggaccaaatgctgtactaagtttcaagcgggaaggttataaaaaa
accgacttcaatgcgaaagatttaactgaagttttaagctataaaggtttttggaagctg
gctagtaaattcatgaaggaagggatggatgagtatgtccgctcttttagtaaaaagcaa
tttacgaaaagcctgcaggaattaattccggaaattcaagaagatgatttaatccctgca
ccttctggagtgcgggcccaggcgttacaggatgatggtaatatggtggatgattttcat
attataatggggaaacggaccattcatgtatgtaatgcaccgtcacctgctgcaacagcc
tcaattgaaattggaaaagaggttgttaaccggattccggaacaatcacacttattggaa
gctgtattgacaaaataa

DBGET integrated database retrieval system