KEGG   Bacillus simplex: UP17_18300Help
Entry
UP17_18300        CDS       T04304                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
bsj  Bacillus simplex
Pathway
bsj00430  Taurine and hypotaurine metabolism
bsj00620  Pyruvate metabolism
bsj00640  Propanoate metabolism
bsj00680  Methane metabolism
bsj01100  Metabolic pathways
bsj01120  Microbial metabolism in diverse environments
bsj01200  Carbon metabolism
Module
bsj_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:bsj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    UP17_18300
   00640 Propanoate metabolism
    UP17_18300
  09102 Energy metabolism
   00680 Methane metabolism
    UP17_18300
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    UP17_18300
Enzymes [BR:bsj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     UP17_18300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AMM94192
UniProt: A0A127DAT6
Position
complement(3925269..3926471)
Genome map
AA seq 400 aa AA seqDB search
MSKIMAINAGSSSLKFQLFEMPSENVITKGLVERIGLKNSTFTLSVEGKKVSETVHIPNY
EVAVGLLLKKLIYHRIIESFEEIDGVGHRVVHGGEVFSDSVLITVEVIEEIEKLSELAPL
HNPANITGIKAFRQILDVPAVAVFDTAFHQTMAADSYLYSLPFEYYENYGIRKYGFHGTS
HKYVSQRAAAMIGRPIEQLRLLSCHLGNGASITAIKGGKSIDTSMGFTPLAGVTMGTRSG
NIDPALIPYIMEKTGKTADEVLDVLNKKSGILALSGFSSDLRDIQVEADKGNDRAVLALE
VFADRIHKYIGSYSAKMGGVDGIIFTAGIGENSQAIRGRILEGLEFMGVYWDKDLNRTSG
KEAFINTPYSPVKVMVIPTNEEIMIVRDTMRLAFSENMTS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaatcatggctattaatgctggcagctcttcattgaagtttcaactttttgag
atgccaagtgaaaacgtaattacaaagggtcttgtagaaaggattggcttgaaaaattcc
acattcactttgagcgtcgaaggcaaaaaggtatctgaaacggtgcatatacccaactat
gaagtggcagtagggcttttattgaaaaagctgatttaccatcgcatcattgaatccttt
gaagagatagatggcgtagggcatcgggttgtgcatggtggtgaggtgttcagtgactcc
gtcttgattacggtggaagtaatagaggaaatcgaaaagctttccgagttggcacccctt
cataatcccgccaatatcacgggaatcaaagccttcaggcaaatacttgatgttcctgct
gttgccgtattcgatactgcctttcatcaaacgatggctgcagattcatatttgtacagc
ttaccctttgaatattatgaaaactatggaataaggaaatatgggtttcatggtacttca
cataaatatgtgtcgcagcgggctgcagcaatgattggccgcccaatcgaacagcttcgc
ttgttatcctgccatttagggaatggtgcaagcattacggccataaagggcggtaaatcg
attgatacatcaatgggatttacaccattggccggtgttacaatggggacgcgttcaggc
aacatcgaccctgcgctgattccatatatcatggagaagacgggaaaaacggctgatgaa
gtgctggatgtcctgaataagaaaagcggcattctagccctttccgggttttccagcgac
ctgcgcgatatacaagtggaagcggataaaggcaatgatcgtgctgtactcgcacttgaa
gtttttgcagatcggattcacaagtacataggttcctattcggctaaaatggggggtgtg
gacggcatcatttttacagcgggcatcggtgaaaacagtcaagccattagggggcgaatc
ttggagggacttgaattcatgggggtatattgggataaggatctcaaccgtacctcgggt
aaggaagccttcatcaatacaccttattcccccgtgaaagtgatggtcattcccactaat
gaagaaatcatgattgtcagggataccatgagattggcttttagcgaaaacatgacttca
tga

DBGET integrated database retrieval system