KEGG   Bacillus simplex: UP17_22385Help
Entry
UP17_22385        CDS       T04304                                 

Definition
(GenBank) 1-pyrroline-5-carboxylate dehydrogenase
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
bsj  Bacillus simplex
Pathway
bsj00250  Alanine, aspartate and glutamate metabolism
bsj00330  Arginine and proline metabolism
bsj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    UP17_22385
   00330 Arginine and proline metabolism
    UP17_22385
Enzymes [BR:bsj01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     UP17_22385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh SPW
Motif
Other DBs
NCBI-ProteinID: AMM94855
UniProt: A0A127DCL0
Position
4772478..4774019
Genome map
AA seq 513 aa AA seqDB search
MISYKHEPFVDFTNEENKKAYQEALQTVEGYLGQDYPLYIGAEKVTTDEKIVSYNPADKE
EVIGRVSKANRDLAEKAMQEASSAFESWKKVKPEIRADVLFKAAAIIRRRKHEFSALLTK
EAGKPWNEADADTAEAIDFLEFYARQMLTLKDGVPVQSRPGEFNRYDYIPLGVGIIISPW
NFPFAIMAGTAVAAIVTGNTILLKPASTTPIVAAKFVEVMLEAGLPAGVLNFVPGNGAEV
GDYLVDHPKTRFISFTGSRDVGLRIYKRASEVNEGQVWLKRVIAEMGGKDTIVVDKEADL
ELAAQSIVKSAFGFSGQKCSACSRAVIVEDVYDQVLARAVELTKQLTVGNPVENHFMGPV
IDQAAFDKIMSYVEIGNQEGRILTGGEGDSSKGYFVQPTIVADVDPQARLMQEEIFGPVV
AFTKAKDFNEALEIANNTEYGLTGAVITTNRLNMEKAREEFHVGNLYFNRGCTGAIVGYQ
PFGGFNMSGTDSKAGGPDYLQLHMQAKTTSETF
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgatttcatataaacatgaaccatttgtcgattttacaaacgaggaaaacaagaaagct
tatcaggaggctcttcaaactgttgaaggctacttagggcaagactaccctctttatatc
ggggcagaaaaagtgacgactgatgagaaaatcgtttcatataaccctgcagataaggaa
gaggtcatcggccgagtatcgaaagcgaacagggatcttgctgaaaaggccatgcaggaa
gcttcttccgcttttgaaagctggaaaaaagtgaagccggaaatccgtgctgacgtttta
ttcaaagctgctgccatcattcgcagacgcaagcatgagttctctgcattattgacaaaa
gaagcaggaaaaccttggaatgaggctgatgccgatacagcggaagcgatcgatttcctt
gaattctatgcccgtcaaatgttgacgcttaaagatggtgtgccagttcaaagccgtcca
ggagaatttaaccgctatgattacattccattaggagtcggcatcatcatttctccttgg
aacttcccatttgccatcatggcaggtacagctgttgcggctatcgtaactggtaacaca
atcctattaaaaccagcttcgactactcctattgttgctgcgaaattcgttgaagtgatg
cttgaagccggccttccagcaggtgtcttgaatttcgttccaggaaacggagccgaagtg
ggcgactacctggttgatcatccaaaaacacgtttcatttccttcactggttcacgtgat
gtaggtctgcgtatttacaaacgggcttcagaagtgaacgaaggccaagtttggctgaag
cgtgtcattgctgaaatgggcggaaaagatacgatcgtcgtcgacaaagaggctgatttg
gaattggctgctcaatcgatcgtgaaatctgcatttggcttctcgggacaaaaatgttct
gcttgctcccgtgctgtcatcgttgaagatgtatatgatcaagttttagctcgcgctgtt
gaattaacaaaacagcttacagttggtaatcctgtagaaaatcatttcatgggaccggtt
atcgatcaagctgcttttgataaaatcatgagctacgttgaaatcggaaaccaagaagga
cgcattctgactggaggagaaggagatagctctaaaggctacttcgttcaaccgacaatc
gtcgctgatgtcgatccgcaagcccgtttgatgcaagaagaaatcttcggaccagtcgtt
gcctttacaaaagcgaaggactttaacgaagctcttgaaattgccaataacacagaatat
ggtttgactggggctgtcattacgacaaaccgccttaatatggaaaaggcacgtgaagaa
ttccatgtgggtaacttgtatttcaaccgcggctgtactggtgcaatcgtaggttatcag
ccattcggcgggttcaacatgtcaggaaccgattccaaggcaggcggaccggactacttg
cagcttcatatgcaagccaaaacaacttccgaaacgttctga

DBGET integrated database retrieval system