KEGG   Brucella canis HSK A52141: BCA52141_I0040Help
Entry
BCA52141_I0040    CDS       T01705                                 

Definition
(GenBank) succinate CoA transferase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
bsk  Brucella canis HSK A52141
Pathway
bsk00020  Citrate cycle (TCA cycle)
bsk00620  Pyruvate metabolism
bsk00650  Butanoate metabolism
bsk01100  Metabolic pathways
bsk01110  Biosynthesis of secondary metabolites
bsk01120  Microbial metabolism in diverse environments
bsk01130  Biosynthesis of antibiotics
bsk01200  Carbon metabolism
Module
bsk_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bsk_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bsk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BCA52141_I0040
   00620 Pyruvate metabolism
    BCA52141_I0040
   00650 Butanoate metabolism
    BCA52141_I0040
Enzymes [BR:bsk01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     BCA52141_I0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CitF LUD_dom CoA_trans
Motif
Other DBs
NCBI-ProteinID: AEW13064
Position
1:26134..27624
Genome map
AA seq 496 aa AA seqDB search
MLEARIRNSSLRNKVITAEQAASFIKDGMIVGMSGFTRAGDAKAVPVAMAARAATDPFQI
TLITGASLGHDVDKLLTEAHILSRRMPFQADRTLRSAINRGEVMFIDQHLSETVEQLRSN
QIGPIDCAVVEALAITESGGIIPTTSVGNSASLAILAEKVIVEVNLNQPMALEGLHDIYI
PTKRPSRDPIPIMACDSRIGLPYIPIAPEKIAGIVITQENDSASPVEPADHETVAIAGHL
IEFFKGEVVKGRLDLALNPLQAGIGTIANAVLTGFADSPFHNLRMYSEVLQDSTFDLFDA
GKLDFASGSSITLSPACGERVFNNIDRYRDRLVLRPQEISNHPEVIRRLGIIGINTALEF
DIYGNVNSTHVDGTNMMNGIGGSGDFARNAYISIFVSKSEAKNGAISSVVPMVTHVDHTE
HDVDILVTEQGLADLRGLAPRERAPVIIENCAHPDYRDKLMDYYERACKRGGHTPHLLEE
AFSWHLRRQENGSMRK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgttggaagcacgtatccgtaacagttcactgcgaaacaaggttatcactgcggagcaa
gcggcaagctttatcaaggatggcatgattgttggcatgagcggctttacgcgcgcgggc
gatgccaaggccgttccggtcgccatggccgcgcgggcggcaaccgatccattccagatc
accctgattacaggggcctccctcggacatgacgtcgataaactgttgaccgaagcgcat
attctttctcgccgtatgccgtttcaggccgaccgcacattgcgcagcgcgatcaaccgc
ggcgaagtcatgtttatcgaccagcatctttccgaaacagtcgagcaacttcgttccaac
cagatcggccccatcgactgtgccgtggtagaggcattggcgattaccgaaagcggcgga
atcatcccgacgacttcggtcggcaattcggccagcctcgccattcttgccgaaaaggtt
atcgtcgaggtcaatctgaaccagcccatggcgctggaaggcctgcacgatatttatata
ccgacgaagcgcccttcccgcgatcctatcccgatcatggcttgcgatagccggatcgga
ctgccctatattcccatcgcgccggaaaaaatcgccggtatcgtcatcacgcaggaaaat
gacagtgcgtcacctgtcgagcccgcagatcacgaaacggttgcgattgccgggcatctg
atcgaattcttcaagggggaagtcgtaaagggtcgtctggatctggcgcttaatccattg
caggcgggcatcggcaccattgccaatgcggttttgaccggctttgcagatagtcctttc
cacaatctgcgcatgtatagcgaggtattgcaggatagcacgttcgatctgttcgatgcg
ggcaagctggattttgcctccggctcatcgatcactctcagccccgcttgcggcgagcgc
gttttcaataatatagaccgctatcgtgacaggcttgtcctgcgcccgcaggaaatcagc
aaccatccggaagtcatccgccgtcttggtattatcggcatcaataccgcactcgaattc
gatatctacggcaacgtcaactcaacccatgttgatggaaccaatatgatgaacggcatt
ggcggttccggcgattttgcgcgcaacgcctatatttcgatcttcgtcagcaagtcggaa
gccaagaatggcgcgatctcctcggtcgtgcccatggtaacacatgtggaccacacggaa
catgacgtggatatcctcgtgacggaacagggacttgccgatttgcgcgggcttgcacca
cgcgagcgagcgcccgttatcattgaaaattgcgcacatcccgattaccgggacaagctc
atggattattacgagcgagcctgcaaacgcggcggccacacgcctcatcttctggaagag
gcattcagttggcacctgcgccgtcaggaaaatggcagtatgcgcaaataa

DBGET integrated database retrieval system