KEGG   Brucella canis HSK A52141: BCA52141_I1568Help
Entry
BCA52141_I1568    CDS       T01705                                 

Definition
(GenBank) 4a-hydroxytetrahydrobiopterin dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
bsk  Brucella canis HSK A52141
Pathway
bsk00790  Folate biosynthesis
bsk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BCA52141_I1568
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsk04147]
    BCA52141_I1568
Enzymes [BR:bsk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     BCA52141_I1568
Exosome [BR:bsk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCA52141_I1568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AEW14010
Position
1:966575..966868
Genome map
AA seq 97 aa AA seqDB search
MARNRLTESEMNEALRALDGWQKVDGREAITRSFKFKDFSTAFGFMAQAALYAEKLDHHP
EWFNAYNRVDVTLATHSENGVTELDIKMARKMNAIAG
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaaccgattgacggaaagcgaaatgaacgaggcgctcagggcgctggacggc
tggcagaaagttgatgggcgcgaggcaatcactcgcagcttcaaattcaaggatttcagc
accgccttcggtttcatggcgcaggcagcactttacgcagaaaagctcgaccatcacccc
gaatggttcaatgcctataaccgtgtggacgtaacacttgcgacccacagcgaaaacggg
gttacagaactggatatcaagatggcgcgcaagatgaacgcgatcgccggttga

DBGET integrated database retrieval system