KEGG   Brucella canis HSK A52141: BCA52141_I2247Help
Entry
BCA52141_I2247    CDS       T01705                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
bsk  Brucella canis HSK A52141
Pathway
bsk00330  Arginine and proline metabolism
bsk00332  Carbapenem biosynthesis
bsk01100  Metabolic pathways
bsk01130  Biosynthesis of antibiotics
bsk01230  Biosynthesis of amino acids
Module
bsk_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BCA52141_I2247
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    BCA52141_I2247
Enzymes [BR:bsk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     BCA52141_I2247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA DUF3708
Motif
Other DBs
NCBI-ProteinID: AEW14419
Position
1:1385986..1387122
Genome map
AA seq 378 aa AA seqDB search
MLKKLKDYRRIVVKIGSALLVDRATGLKREWLESLGQDIAALQHAGVEVLVVSSGAIALG
RTVLGLPKKALKLEESQAAAAAGQIALAKAYADVLGGHGIKSGQILVTLSDTEERRRYLN
ARATIETLLKLKAVPIINENDTVATTEIRYGDNDRLAARVATMMGADLLILLSDIDGLYT
APPHKNPDAQFLPFVETITPQIEAMAGAAASELSRGGMKTKLDAGKIANAAGTAMIITSG
TRFGPLSAIDRGERATLFEAAHAPVNAWKTWISGNLEPAGRLTVDAGAVKALKSGKSLLP
AGVKEVDGDFERGDTVAVMNEDGREIARGLIAYDAADARKVAGHKSDEISAILGYDARAA
MIHRNDLVVRAASDAKAA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaaactaaaagactatcgccgcatcgttgttaaaataggctctgcccttctg
gtggaccgggccacaggcctgaagcgcgaatggctggaaagcctggggcaggatattgcc
gccttgcagcatgcgggcgttgaggtgctggtggtttcgtcgggtgcaattgcactgggg
cgcacggttctgggcctgccgaaaaaggcgctgaagcttgaggaaagccaggcggcggca
gcagccgggcagattgcgctggcgaaggcttatgcggatgtgctgggcggacatggcatc
aagtcgggacagattctggtcacgctttccgatacggaagagcgccgccgctatctcaat
gcgcgcgcaaccatcgagaccctgctgaagctcaaggccgtgccgatcatcaatgaaaac
gatacggtggcaaccaccgaaatccgttatggcgacaatgacaggttggcggcgcgcgtc
gcgaccatgatgggcgcggaccttctgatcctgctttccgacattgacgggctttatacc
gcgccgccgcacaagaatccggatgcgcaatttctgccctttgtcgaaaccatcacgccg
cagatcgaagccatggcgggggcggcagcatccgagctttcgcggggtggcatgaagacc
aagctcgatgcgggcaagattgcaaacgctgccgggaccgcgatgattatcacttcgggc
acgcgtttcggcccgctttcggcaattgaccgaggggagcgtgcgacattgttcgaggct
gcccatgcgccggtcaatgcgtggaagacgtggatttccggcaatctggaaccggctggc
cggttgactgtggatgcgggtgctgtcaaggcgctcaaatccggcaaatcgcttttgcct
gcgggcgtgaaggaagttgacggggatttcgagcgtggcgacacggttgccgtcatgaac
gaggatgggcgggagattgcgcgcggtctgatcgcctatgatgctgctgacgcccgcaag
gttgccgggcataaaagcgatgagatcagtgccattcttggctatgatgcccgcgcggcg
atgatccatcgcaacgatctggtggtgcgggccgccagcgatgcgaaagccgcatag

DBGET integrated database retrieval system