KEGG   Brucella canis HSK A52141: BCA52141_I2367Help
Entry
BCA52141_I2367    CDS       T01705                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsk  Brucella canis HSK A52141
Pathway
bsk00071  Fatty acid degradation
bsk00072  Synthesis and degradation of ketone bodies
bsk00280  Valine, leucine and isoleucine degradation
bsk00310  Lysine degradation
bsk00362  Benzoate degradation
bsk00380  Tryptophan metabolism
bsk00620  Pyruvate metabolism
bsk00630  Glyoxylate and dicarboxylate metabolism
bsk00640  Propanoate metabolism
bsk00650  Butanoate metabolism
bsk00900  Terpenoid backbone biosynthesis
bsk01100  Metabolic pathways
bsk01110  Biosynthesis of secondary metabolites
bsk01120  Microbial metabolism in diverse environments
bsk01130  Biosynthesis of antibiotics
bsk01200  Carbon metabolism
bsk01212  Fatty acid metabolism
bsk02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BCA52141_I2367
   00630 Glyoxylate and dicarboxylate metabolism
    BCA52141_I2367
   00640 Propanoate metabolism
    BCA52141_I2367
   00650 Butanoate metabolism
    BCA52141_I2367
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BCA52141_I2367
   00072 Synthesis and degradation of ketone bodies
    BCA52141_I2367
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BCA52141_I2367
   00310 Lysine degradation
    BCA52141_I2367
   00380 Tryptophan metabolism
    BCA52141_I2367
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BCA52141_I2367
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BCA52141_I2367
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BCA52141_I2367
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsk04147]
    BCA52141_I2367
Enzymes [BR:bsk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BCA52141_I2367
Exosome [BR:bsk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BCA52141_I2367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEW14493
Position
1:1458808..1459992
Genome map
AA seq 394 aa AA seqDB search
MSDPKSIVIASAARTAVGAFNGAFANVPAHELGAVAIKAALERAGVDAADVDEVILGQVL
TAGEGQNPARQAAMGAGCPKETTAFAINQLCGSGLRAVALGMQQIVSGDAKIIVAGGQES
MSMAPHCAYLRSGVKMGDFKMIDTMLKDGLTDAFHGYHMGITAENIARQWQLSRSEQDEF
ALASQHKAEAAQKAGRFDEEIVPFTVKARKGDVVVSADEYIRPGTTMEVLAKLKPAFDKE
GTVTAGNASGINDGAAAVVLMDAGEAARRGVKPLARIVSWATAGVHPSIMGTGPISATRK
ALEKAGWSVGDLDLVEANEAFAAQSCAVVRDLGLNPEIVNVNGGAIAIGHPIGASGARVL
TTLLYEMERRDAKRGLATLCIGGGMGVALCVERD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatccgaaatccatcgtcatcgccagtgcagcgcgcaccgcggtgggtgccttt
aatggcgcctttgccaatgttcctgctcatgaactgggtgcagtggccatcaaggctgct
ctggagcgtgctggtgtcgatgcggcggatgtcgatgaggttattctggggcaggtgctg
acggcaggcgaagggcagaatcccgcccgtcaggccgccatgggggccggttgcccgaag
gaaaccaccgcttttgccatcaaccagctctgcggttccggcctgcgggcggttgcgctc
gggatgcagcagattgtttccggcgatgcgaagattatcgtggcgggcgggcaggaatcc
atgtccatggcgccgcattgtgcctatctgcgctccggcgtgaagatgggcgatttcaag
atgatcgacaccatgctgaaagacggcctgaccgatgctttccatggctatcacatgggc
atcaccgctgaaaatattgcgcgccaatggcagttgagccgcagcgagcaggacgagttc
gcactcgcctcgcagcacaaagccgaggccgcgcagaaggcaggccgcttcgatgaggag
atcgtgcctttcaccgtcaaggcccgcaagggggatgttgtggtttcggcagatgaatat
atccgtccgggcacgacgatggaggtgctggccaagctgaagccggcttttgacaaggaa
ggcacggtgacggcgggcaatgcatccggcatcaatgacggtgccgcagcggttgtgctg
atggatgctggcgaggcagccaggcgtggcgtgaagcctctggcgcgcatcgtatcctgg
gcgacggctggcgttcatccgtcgatcatgggaaccgggccgatttccgcaacgcggaag
gcgctggaaaaggcaggctggagcgttggcgaccttgatcttgttgaggccaatgaggcc
tttgcagcgcagtcatgcgcggtggtgcgcgatctgggtctcaatcctgaaatcgtcaat
gtcaatggcggcgcaatcgccatcggccatccgatcggcgcctccggcgcccgcgtgctg
acgacgctgctctacgaaatggagcgtcgcgatgccaagcgtggtctggcgacgctttgt
atcggcggcggcatgggcgtggccctttgtgtcgagcgggattga

DBGET integrated database retrieval system