KEGG   Brucella canis HSK A52141: BCA52141_I2554Help
Entry
BCA52141_I2554    CDS       T01705                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bsk  Brucella canis HSK A52141
Brite
KEGG Orthology (KO) [BR:bsk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsk03009]
    BCA52141_I2554
Enzymes [BR:bsk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     BCA52141_I2554
Ribosome biogenesis [BR:bsk03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BCA52141_I2554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2
Motif
Other DBs
NCBI-ProteinID: AEW14603
Position
1:1559014..1560018
Genome map
AA seq 334 aa AA seqDB search
MKELIADSDAAGKRLDQWLAAALGPELSRSRVQSLIADGHVTIDGAPARETKQKLREGMN
IAIVLPEPEPAEPQGENIPLDILYEDDDLIVINKPAGLVVHPGNGNWTGTLVNALIYHCG
DSLSGIGGIRRPGIVHRLDKDTSGVMVVAKNDRAHRHLSEQFADHGRTGDLERAYLALVW
GMTERPQGTVDAYLGRSHRDRTKQAVVHEEREDARHAITHYATVEKFSPREDATALASLV
ECRLETGRTHQIRVHMAHIGHPLVGDMDYGSAYKTKANKLPEPLKEAVQGFHRQALHAWL
LAFTHPITEELMRFEAPLPEDMEQLLENFRRCTI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagagctaattgccgactccgatgccgcaggcaagcgtctggaccagtggctggcc
gctgcattggggccggaactctcccgcagccgcgttcagtccctgattgccgatggccat
gtgaccatcgacggcgcgcccgcccgcgagacgaaacagaaactgcgcgaaggcatgaac
atcgccatcgtgctgcctgagcctgaacccgccgaaccgcaaggcgagaacatcccgctc
gatattctttacgaggacgatgatctcatcgtgatcaacaagcctgccgggcttgtcgtt
cacccaggcaatggcaactggactggaacgctggtcaatgccctcatatatcattgtggt
gatagcttgtcaggaattgggggaatccgccgccccggcattgttcaccggctcgacaag
gacacaagcggcgtcatggtggtggccaagaacgaccgcgcccaccgccatctgagcgaa
caatttgccgatcatggccgcaccggcgatctggagcgcgcctatctggccctcgtctgg
ggcatgaccgagcgtccgcaaggcacggttgacgcctatctcggccgttcgcaccgcgac
cgcaccaaacaggccgtcgtacatgaagagcgcgaggatgcccgccacgccatcacccat
tatgcaaccgtggaaaaattcagcccccgcgaggatgcaaccgcccttgcctcgctggtg
gaatgtcgtcttgaaacaggccgcacccaccagattcgcgtccatatggcccatatcggt
catcccctggtgggcgatatggattatggcagtgcctacaagaccaaggccaacaaattg
ccggaaccgctgaaagaggctgtgcaaggctttcaccggcaggcgcttcacgcctggctt
ctggccttcacccatccgatcacggaagaactgatgcgttttgaagcgccgttgccggaa
gatatggagcagcttctggaaaacttccggcgctgcactatataa

DBGET integrated database retrieval system