KEGG   Brucella canis HSK A52141: BCA52141_II0097Help
Entry
BCA52141_II0097   CDS       T01705                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bsk  Brucella canis HSK A52141
Pathway
bsk00030  Pentose phosphate pathway
bsk00480  Glutathione metabolism
bsk01100  Metabolic pathways
bsk01110  Biosynthesis of secondary metabolites
bsk01120  Microbial metabolism in diverse environments
bsk01130  Biosynthesis of antibiotics
bsk01200  Carbon metabolism
Module
bsk_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bsk_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
bsk_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:bsk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BCA52141_II0097
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BCA52141_II0097
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsk04147]
    BCA52141_II0097
Enzymes [BR:bsk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BCA52141_II0097
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BCA52141_II0097
Exosome [BR:bsk04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BCA52141_II0097
  Exosomal proteins of colorectal cancer cells
   BCA52141_II0097
  Exosomal proteins of bladder cancer cells
   BCA52141_II0097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AEW15236
Position
2:complement(73319..74794)
Genome map
AA seq 491 aa AA seqDB search
MTSQTIPVDPFDCIVFGGTGDLAERKLIPALYQRQRAGQLSDPTRIIGASRSQMTDDKYR
TFAGNAIKEHVKPEEVDQAEVEIFLKRLHYVAVDAKSDEGWDALKTLIGKKPEKIRAFYL
AVSPTLFGDIATRLKAHGLITRDTRIVVEKPIGRDLDSAKALNDTLGSVFREDQIFRIDH
YLGKETVQNLMALRFANALYEPLWNSAHIDHVQITVAEAVGLEGRAGYYDKAGALRDMVQ
NHILQLLCLVAMEPPSSIEADAVHDEKVKVLRSLQPISTHNVEELTVRGQYRAGASAGGP
VKGYLEDLESDTSNTETFVALKAEIANWRWAGVPFYLRTGKRLATRVSEIVVTFKPIPHS
IFGESAGKVIANQLVIRLQPDEGVKQWLMIKDPGPGGMRLRHMPLDMSFAESFEDRNPDA
YERLIMDVVRGNQTLFMRRDEVEAAWRWIDPILQAWEFNSQPVQGYTAGTWGPSSSIALI
ERDGRTWHESL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtcagacaattccggtagatcccttcgactgcatcgtttttggtggcaccggc
gatcttgccgagcgcaagcttattccggcgctttatcagcgccagcgcgcaggccagctt
tccgaccccacacgcatcatcggcgcctcgcgcagccagatgaccgacgacaaatatcgc
accttcgccggcaatgcgatcaaggaacatgtgaaaccggaagaggtggatcaggccgaa
gttgaaatcttcctcaagcggctgcactatgtggcggtggacgccaagtccgacgagggc
tgggatgcgctgaagaccctgatcggcaagaagccggaaaagatccgagccttttatctg
gccgtcagcccgaccctgttcggcgatatcgccacgcggctcaaggcgcatggcctcatc
acgcgcgatacgcgcatcgtcgtggaaaagccgattggccgcgatctcgattccgccaag
gcgctcaacgacacgctgggcagtgtgttccgcgaagaccagattttccgcatagaccac
tatctcggcaaggaaacggtgcagaacctgatggcgctgcgctttgccaatgcgctctac
gagccgctgtggaactccgcccatatcgaccatgtgcagatcacggtggcggaagccgtg
ggccttgaaggccgcgcaggctattacgacaaggcgggcgcgctgcgcgacatggtgcag
aaccacattctccagcttctctgccttgttgccatggaaccgccatcctcgattgaggcc
gacgccgtacacgacgagaaggtaaaggttctgcgctccctgcagccgatctccacgcat
aatgtcgaggaactgacggtccgcggacaatatcgcgcgggcgcttccgcaggcgggccg
gtcaagggctatctggaagaccttgaaagcgacaccagcaatacggaaacattcgtggcg
ctgaaggcggaaatcgccaactggcgctgggcgggtgtgccgttctatctgcgcaccggc
aagcgccttgccacgcgtgtttcggaaatcgtcgtcacgttcaagcccattccgcattcc
atctttggcgaaagcgcgggcaaggtgattgccaatcagcttgtcatccgcctgcaaccg
gacgaaggcgtgaagcaatggctgatgatcaaggatcccggtccgggtggaatgcgcctg
cgccacatgccgctcgacatgagctttgcggaatccttcgaggatcgcaacccggatgcc
tatgagcgcctcatcatggatgtggtgcgcggcaaccagaccctgttcatgcgccgcgac
gaagtggaagcggcctggcgctggatcgacccgatccttcaggcatgggagttcaacagc
cagcccgtgcagggctatacggctggcacatgggggccttcgtcctccatcgcgctcatt
gagcgcgatggccgcacctggcacgaaagcctctaa

DBGET integrated database retrieval system