KEGG   Brucella canis HSK A52141: BCA52141_II0575Help
Entry
BCA52141_II0575   CDS       T01705                                 

Definition
(GenBank) Bme26 protein
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bsk  Brucella canis HSK A52141
Pathway
bsk00860  Porphyrin and chlorophyll metabolism
bsk01100  Metabolic pathways
bsk01110  Biosynthesis of secondary metabolites
bsk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsk00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BCA52141_II0575
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsk01007]
    BCA52141_II0575
Enzymes [BR:bsk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BCA52141_II0575
Amino acid related enzymes [BR:bsk01007]
 Aminotransferase (transaminase)
  Class III
   BCA52141_II0575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEW15527
Position
2:complement(374265..375626)
Genome map
AA seq 453 aa AA seqDB search
MNLFTSQFRNSQLLASKAHALIPGGCHTYAKGDDQYPVLAPGFIQRGSGAHVFDVDGHEY
IEYGMGNRAVGLGHAYPPVVRAVREALQDGCNFTRPSAIELDCAESFLELIEGAEMVKFC
KDGSDATSGALRLARAYTGRDMVACCADHPFFSTDDWFIGTTKMSAGIPASVSALTATFR
YNDIASVEALFEDYPGRIAAIIMEPARADEPQDNFLHEAMRIAHENGALFILDEMITGFR
WHMRGAQKLYGIVPDLSCFGKALGNGFAISALAGKAEYMRLGGLHHTDFPRVFLLSTTHG
AETHAMAAAIATMAIYRDEPVIERLYEQGAKLAAGINEAIAGHRLQDHVRLSGRPCCLTY
STLDGNGMPSQAFRILFLQETIRRGVLMPSLVVSYTHSDADIARTIDAVHGALGIYVRAL
NDGVESCLVGRPSQVVYRRFNEDPASSCPPPRL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaccttttcacatcgcagtttcgcaattcgcaattgctggccagcaaggcccatgcg
ctcattcccggcgggtgccatacctatgccaagggagacgatcagtatccggtgcttgcg
ccgggtttcatccagcgcggttcaggcgcccatgtcttcgacgtggatggccacgaatat
atcgaatatgggatgggaaaccgcgccgtcggcctcggccatgcctatccgccggtggtg
cgagccgtacgcgaggccttgcaggatggctgcaattttacccggccaagtgctatcgaa
ctcgactgcgcggaaagctttctcgaactgattgagggggcggaaatggtcaaattctgc
aaggacggctcggatgcgacttccggcgcgcttcgccttgcccgcgcctatacagggcgt
gacatggtggcctgctgcgccgaccatcccttcttttcgaccgacgactggttcattggc
accacgaagatgagcgcaggcattcccgcgtcggtttctgcgctcaccgcgacgtttcgc
tataatgatattgccagtgtcgaggcgcttttcgaggactatccggggcgcatcgccgcc
atcatcatggagccggcgcgcgcagatgagccgcaagacaattttctccatgaagccatg
cgcattgcccatgaaaacggtgcacttttcattctggatgaaatgattaccggctttcgc
tggcatatgcgcggcgcgcagaagctttatggtatcgtgccggacctttcctgtttcgga
aaggcgctcggcaatggctttgccatttctgcgctcgcgggcaaggccgaatatatgcgg
cttggcgggcttcaccatacggatttcccccgcgtctttctgctttccacgacgcatggg
gcggaaacccatgccatggccgcggcgattgccactatggcgatctatcgcgatgagccg
gtgatcgagcgtctttatgaacaaggtgcgaagcttgccgcaggcataaacgaggctatt
gccggtcatcggcttcaggatcatgtgcgcctatcggggcggccttgttgcctcacctat
tccacgctggatggaaacggaatgccttcgcaggcatttcgcatccttttccttcaggaa
acaatccggcgcggcgtgctgatgccctcgctggttgtgagctacacgcatagcgatgcc
gatattgcccgcaccatcgatgcggttcacggtgcgctcggcatctatgtgcgggcgctc
aatgacggcgtggagtcctgtctggtcgggcggccgtcgcaggttgtctatcgccgtttc
aacgaagatccggcttcctcatgcccaccgccaagattgtaa

DBGET integrated database retrieval system