KEGG   Brucella canis HSK A52141: BCA52141_II1132Help
Entry
BCA52141_II1132   CDS       T01705                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bsk  Brucella canis HSK A52141
Pathway
bsk00040  Pentose and glucuronate interconversions
bsk00052  Galactose metabolism
bsk00500  Starch and sucrose metabolism
bsk00520  Amino sugar and nucleotide sugar metabolism
bsk01100  Metabolic pathways
bsk01130  Biosynthesis of antibiotics
Module
bsk_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bsk00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BCA52141_II1132
   00052 Galactose metabolism
    BCA52141_II1132
   00500 Starch and sucrose metabolism
    BCA52141_II1132
   00520 Amino sugar and nucleotide sugar metabolism
    BCA52141_II1132
Enzymes [BR:bsk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BCA52141_II1132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 C_LFY_FLO
Motif
Other DBs
NCBI-ProteinID: AEW15883
Position
2:complement(725392..726285)
Genome map
AA seq 297 aa AA seqDB search
MSSIRKIRKAVFPVAGLGTRFLPATKSIPKEMLTVVDKPVIQYVVDEAREAGIEHLIFVT
GRNKAVIEDYFDAQVELYSTLAERGKTEELNRLQDLQPQPGTTSFTRQQVPLGLGHAVWC
ARELVGNEPFALLLPDMVMQSKKGCLAEMVELYEQTGGNIIAVQECDPEEAHKYGIVGKG
GAVGNGFEITRMVEKPAKGTAPSNLYINGRYILQPEIFGLLSKQEKGAGNEIQLTDAMLK
LADQQKFYGFDYRGLTFDCGSKAGFIEANVAFALWREDIRPSVESSIGHLLKTIQPA
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagttctattcggaaaatccgcaaggcagtctttcccgtcgcaggtcttggaacgcgc
ttcctgcccgcaaccaaatccatcccgaaggaaatgctgacggttgttgacaaacccgtc
atccaatatgtcgtggacgaagcgcgcgaggcgggtattgaacacctgattttcgttacg
gggcgcaacaaggctgtcatcgaggattatttcgatgcgcaggtggagctttattccaca
ctggccgaacgggggaaaaccgaagagttgaaccgcctgcaggatttgcagccgcagccg
ggcaccaccagctttacccgccagcaggtgccgcttggcctcggccacgctgtctggtgt
gcgcgggaactggtgggcaacgaaccttttgcactgcttctgcctgatatggtgatgcag
tcgaaaaagggctgccttgccgaaatggtcgaactttacgaacagaccggcggcaatatc
atcgccgtgcaggaatgcgacccggaagaggcgcataaatacggtatcgtgggcaagggc
ggcgctgtcggcaatggcttcgagattacgcgcatggtcgaaaagccggctaagggcacg
gcgccgtccaatctctatatcaatgggcgctatatcctccagccggagattttcgggctg
ttgagcaagcaggaaaagggtgcgggcaacgaaatccagctgaccgacgccatgctgaag
cttgccgaccagcagaagttctatggcttcgattatcgcgggctgaccttcgattgcggc
tcgaaggcaggcttcattgaggccaatgtggctttcgcactatggcgtgaggatatccgc
ccgtccgtggaaagctccatcggccatctgttgaagacgatccagccagcctga

DBGET integrated database retrieval system