KEGG   Brucella canis HSK A52141: BCA52141_II1161Help
Entry
BCA52141_II1161   CDS       T01705                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bsk  Brucella canis HSK A52141
Pathway
bsk00260  Glycine, serine and threonine metabolism
bsk01100  Metabolic pathways
bsk01110  Biosynthesis of secondary metabolites
bsk01120  Microbial metabolism in diverse environments
bsk01130  Biosynthesis of antibiotics
bsk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BCA52141_II1161
Enzymes [BR:bsk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BCA52141_II1161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AEW15901
Position
2:749531..750580
Genome map
AA seq 349 aa AA seqDB search
MHFASDNWAGAHPKIAESLSLHAAGFAAAYGASEIDKRVEQHFNELFEREVAVFFVGTGT
AANSLALASVNRPGGVSLVHREAHVIEDECGAPEYFTGGARLHPIDGALGRIDPELLKRE
LKRFNPAFVHAGQPMAVSITQATEVGTLYQPEHIATISQICRDAGLPLHMDGARFANALV
SLDLTPAEMTWKLGVDIVSFGGTKNGCWCAEALVFMDPARAKDLPFIRKRAAQLFSKTRF
VAAQFDAYLRDDLWRDLARHSNALAARLANHIHASSQMRLAWKPEANEVFAIMKQSVYDR
LRDAGAVFYDWNPPHSEVGRIGEGEIFARFVTGFANTEEEVDRFGDMIA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
gtgcattttgcgtcagacaattgggcaggcgcccatccaaaaatcgccgagagcctttcg
ctgcatgcagccggttttgcggcagcctatggcgcaagcgagatcgacaaacgtgtggaa
caacacttcaacgaattgttcgagcgtgaagtggccgttttctttgtcggaaccggtacg
gctgccaattcgctggcgctggccagcgtcaaccggcccggcggcgtttcgctggtccac
cgcgaggcgcatgtgatcgaggatgaatgcggcgcaccggaatatttcaccggcggcgca
cgtctccacccgatcgacggcgcgctgggccgcattgatcccgaacttctgaaacgcgaa
ttgaagcgtttcaaccccgccttcgttcacgcgggccagcccatggccgtcagcatcacg
caggcgacggaagtgggtacgctttaccagccggagcatatcgccaccatttcgcaaatc
tgccgcgatgccggactgccgctacacatggatggcgcacgctttgccaatgcgctcgtg
tcgcttgatctcacacctgccgaaatgacatggaaacttggcgtggacattgtgtccttc
ggcggcaccaagaatggctgctggtgcgccgaggcgctggtcttcatggacccggcccgc
gccaaagacctgcccttcatccgcaagcgcgcagcacagcttttctccaagacgcgcttc
gttgccgcgcagttcgatgcctatctgcgtgacgatctctggcgcgaccttgcccgccat
tccaacgcgcttgctgcccgccttgccaaccatatccatgcatcaagccagatgcgcctt
gcctggaaaccggaagccaacgaggttttcgcgatcatgaagcaatcggtttatgaccgt
ctgcgcgatgcgggtgcggtattctacgactggaatcctccgcattcggaagtgggccgc
atcggcgagggcgagatttttgcccgctttgtcaccggcttcgccaatacggaagaagaa
gtggaccgtttcggcgacatgatcgcctga

DBGET integrated database retrieval system