KEGG   Brucella canis HSK A52141: BCA52141_II1228Help
Entry
BCA52141_II1228   CDS       T01705                                 

Definition
(GenBank) ABC transporter
  KO
K02056  simple sugar transport system ATP-binding protein [EC:3.6.3.17]
Organism
bsk  Brucella canis HSK A52141
Module
bsk_M00221  Putative simple sugar transport system
Brite
KEGG Orthology (KO) [BR:bsk00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsk02000]
    BCA52141_II1228
Enzymes [BR:bsk01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.17  monosaccharide-transporting ATPase
     BCA52141_II1228
Transporters [BR:bsk02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Putative simple sugar transporter [MD:M00221]
    BCA52141_II1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran STAS
Motif
Other DBs
NCBI-ProteinID: AEW15945
Position
2:789066..789428
Genome map
AA seq 120 aa AA seqDB search
MIRQYSVRAGAITERLDSLSGGNAQKLIAARELATNPKFLIADQPTRGIDVSAAAFLHRR
IDEVAQGGCAVLLVSADLDELLRLNDRIVVLFNGRIATILDNGPEITPAVLGPYMLGTRA
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgataaggcaatattcggtgcgcgcgggcgccatcaccgaaaggctcgattccctttcc
ggcggcaatgcgcaaaagctgattgccgcgcgtgaacttgccaccaatccgaaattcctg
atcgccgaccagccgacgcgcggcattgatgtttcggcagctgccttcctgcaccgccgc
atcgacgaagtggcgcagggcggttgcgccgtgctgctcgtgagcgccgatctcgatgaa
ttgctgcgcctgaacgaccgcattgtcgttctgttcaacgggcgcatcgccaccattctc
gacaatgggccagagatcacgccggctgtccttggaccttacatgctcggaacgcgagca
tga

DBGET integrated database retrieval system