KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1813Help
Entry
A7A1_1813         CDS       T02384                                 

Definition
(GenBank) Methionyl-tRNA synthetase MetS
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00450  Selenocompound metabolism
bsl00970  Aminoacyl-tRNA biosynthesis
bsl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    A7A1_1813
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A7A1_1813
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsl01007]
    A7A1_1813
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsl03016]
    A7A1_1813
Enzymes [BR:bsl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     A7A1_1813
Amino acid related enzymes [BR:bsl01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   A7A1_1813
Transfer RNA biogenesis [BR:bsl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A7A1_1813
 Prokaryotic type
   Other AARSs
    A7A1_1813
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ARL2_Bind_BART
Motif
Other DBs
NCBI-ProteinID: AGA22431
Position
complement(3996268..3998262)
Genome map
AA seq 664 aa AA seqDB search
MPQENNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQ
QKAEQENITPQEYVDRAAADIQKLWKQLEISNDDFIRTTEKRHKVVIEKVFQKLLDNGDI
YLDEYEGWYSIPDETFYTETQLVDIERNEKGEVIGGKSPDSGHPVELIKEESYFFRMGKY
ADRLLKYYEENPTFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPENPKHVVYVW
IDALFNYLTALGYDTENDELYQKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQVF
AHGWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERIN
YDLANDLGNLLNRTVAMINKYFDGQIGSYKGAVTEFDQTLTSVAEETVKAYEKAMENMEF
SVALSTLWQLISRTNKYIDETAPWVLAKDPAKEEELRSVMYHLAESLRISAVLLQPFLTK
TPEKMFEQLGITDESLKAWDSITAFGQLKDTKVQKGDPLFPRLEAEEEIAYIKGKMQGSA
PAKEETKEEEPQEVDRLPEITIDQFMDVELRVAEVIEAEPVKKADRLLKLQLDLGFEKRQ
VVSGIAKHYTPEELVGKKLVCVTNLKPVKLRGELSQGMILAGEADGVLKVVSIDQSLPKG
TRIK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaagaaaacaatacattttacattacaacaccgatttattatccgagcggaaaa
ttacatatcggccatgcatatacgacagtcgcaggagatgcaatggcacgttacaaaaga
ttaaaagggttcgatgttcgctatttaacgggaacggacgagcatggacaaaagatccag
caaaaagctgaacaggaaaacattacacctcaggagtatgtggatcgcgcagcggcagat
attcaaaaactgtggaagcagcttgaaatctcaaacgacgactttatccgcacgacagaa
aaacggcataaagttgtcattgaaaaggtgtttcaaaagcttcttgataacggggacatc
tatcttgatgagtatgaaggctggtacagcatccctgatgaaacgttctacacggaaact
cagctcgttgatattgagcggaatgaaaagggagaggtcatcggcggaaaaagccctgac
agcggtcacccagttgaattgatcaaagaggaatcttatttcttccgcatggggaaatac
gcggatcgccttctgaaatactatgaagaaaacccgacattcattcagccagaatcacgc
aaaaacgaaatgattaataactttatcaaacctggacttgaggatttggcagtatcacgt
accacttttgattggggcgtgaaggtgccggaaaatccaaagcatgttgtatatgtttgg
attgacgcactatttaactatttaacggcactcggttatgatacagaaaatgatgagctt
tatcaaaaatattggcctgccgatgttcatttagtcggtaaggagattgtacgattccat
actatttactggccaattatgctgatggcgctggatcttccgctgccaaagcaagtattc
gcgcatggctggcttttgatgaaagacggaaaaatgtcgaaatcaaaagggaacgttgta
gatccggttacattaattgaacgctatggtttagacgaacttcgctattacttgcttcgc
gaagtgccgttcggatcagacggtgttttcacgccggaaggatttgttgagcgaatcaac
tatgatttagcgaatgatttaggaaatctattgaatcgtactgttgcgatgattaataag
tattttgacggacaaatcggttcttacaaaggtgctgttacggaatttgaccaaacgctc
acttccgttgctgaagaaacagtgaaagcttatgagaaagcaatggaaaatatggagttc
tcggtagcactttcgactttatggcagctcatcagccgcacaaacaaatacattgatgag
acagctccatgggtgcttgcgaaagatccggcaaaagaagaagaattgcgatcagttatg
tatcacctcgctgaatcattgcgtatttcagcggtactgcttcagccattcttaacaaaa
acacctgaaaaaatgttcgagcagctgggcattactgatgaatctttaaaagcttgggac
agcattacagctttcggccagctgaaagatacaaaagtacaaaaaggcgatccattgttc
cctcgtttagaggcagaagaagaaattgcttacatcaaagggaaaatgcaaggttcagca
ccagcgaaagaagaaacaaaagaagaagagcctcaagaggtcgatcgtttacctgaaatt
acgattgatcaattcatggatgtagagcttcgcgtagctgaggtcattgaggcagagcca
gtgaaaaaagcagaccgtttattgaagctgcagcttgatcttggttttgaaaagcgccaa
gtggtatccggcattgcgaagcattatacgcctgaagagcttgttggaaaaaaactcgtt
tgtgtaacaaatctaaaaccggttaaactcagaggagagctttctcaaggtatgatcctt
gcaggagaagcagacggcgttttaaaggtcgtatctatcgatcagtcgttaccaaaaggc
acaagaattaaataa

DBGET integrated database retrieval system