KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_1915Help
Entry
A7A1_1915         CDS       T02384                                 

Definition
(GenBank) Glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00030  Pentose phosphate pathway
bsl01100  Metabolic pathways
bsl01120  Microbial metabolism in diverse environments
bsl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A7A1_1915
Enzymes [BR:bsl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     A7A1_1915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: AGA22533
Position
complement(3735907..3736683)
Genome map
AA seq 258 aa AA seqDB search
MYKDLTGKTAIVTGSSKGIGKAIAERFGQEKMNVVVNYHSDPSGADETLEIIKQNGGKAV
AVEADVSKEEGIQALLDTALEHFGTLDVMVNNSGFNGVEAMPHEMSLEDWQRVIDVNVTG
TFLGAKAALNHMMKNNIKGNVLNISSVHQQIPRPVNVQYSTSKGGIKMMTETLALNYADK
GIRVNAIAPGTIATESNVDTKKEESRQKQLKKIPMKAFGKPEEVAAAAAWLVSEEASYVT
GATLFVDGGMTLYPSQLE
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagatttaaccggaaaaacagcgattgtgacagggtcttcaaaaggaatcggg
aaagccattgcggaacggttcggacaggagaaaatgaatgttgttgtaaactaccacagc
gacccgtctggagccgatgaaaccctggaaatcattaagcagaacggagggaaagccgtc
gcagttgaggcggacgtgtcaaaagaagaggggattcaggcgctcttggacacagcatta
gagcatttcggcacgctcgatgtgatggtaaacaactctggttttaacggcgttgaggcg
atgccgcatgagatgagtcttgaagattggcagagagtgattgatgtcaatgttaccgga
acttttctgggagcgaaagcagcacttaaccacatgatgaaaaacaatatcaagggcaat
gtgttgaatatctcaagtgttcatcagcagattccgcgccctgtaaacgttcagtattcc
acatccaaaggcggcatcaagatgatgacggaaacgctggcgctcaattatgcggataag
ggaatccgcgtcaatgcgatagcgcccggcaccattgccacagaatcaaatgttgatacg
aaaaaggaagagagcaggcaaaaacaattgaaaaaaatcccgatgaaagccttcggaaag
cctgaagaagtggcggcagcagcagcttggctcgtatctgaggaagcaagctatgtgacc
ggcgcaacacttttcgtcgacggcggaatgacactttatccatctcagcttgaatag

DBGET integrated database retrieval system