KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_2967Help
Entry
A7A1_2967         CDS       T02384                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00790  Folate biosynthesis
bsl01100  Metabolic pathways
Module
bsl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bsl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A7A1_2967
Enzymes [BR:bsl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     A7A1_2967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AGA23585
Position
1815656..1816228
Genome map
AA seq 190 aa AA seqDB search
MKEVNKEQIEQAVRQILEAIGEDPNREGLLDTPKRVAKMYAEVFSGLNEDPKEHFQTIFG
ENHEELVLVKDIAFHSMCEHHLVPFYGKAHVAYIPRGGKVTGLSKLARAVEAVAKRPQLQ
ERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGVFKDDAAARA
EVLEHIKRQD
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagttaataaagagcaaatcgaacaagctgttcgtcaaattttagaagcgatc
ggagaagacccgaatagagaagggcttcttgatactccgaaaagagtcgcaaagatgtat
gccgaagtattctccggcttgaatgaagatccaaaagaacatttccagactatcttcggt
gaaaaccatgaggagcttgttcttgtaaaagatatcgcgtttcattctatgtgtgagcat
caccttgttcccttttatggaaaagcacatgttgcatatatcccgcgaggcggaaaggtc
acaggactcagcaaactggcacgtgccgttgaagccgttgcaaagcgcccgcagcttcag
gaacgcatcacttctacaattgcagaaagcatcgtagaaacgcttgatccgcatggcgta
atggtagtggttgaagcggaacacatgtgcatgacgatgcgcggtgtaagaaaaccgggt
gcgaaaactgtgacttcagcagtcagaggcgtttttaaagatgatgccgctgcccgtgca
gaagtattggaacatattaaacgccaggactaa

DBGET integrated database retrieval system