KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_3515Help
Entry
A7A1_3515         CDS       T02384                                 

Definition
(GenBank) Hypothetical protein YloI
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00770  Pantothenate and CoA biosynthesis
bsl01100  Metabolic pathways
Module
bsl_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:bsl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    A7A1_3515
Enzymes [BR:bsl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     A7A1_3515
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     A7A1_3515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein NAD_binding_7 ATPgrasp_N
Motif
Other DBs
NCBI-ProteinID: AGA24133
Position
complement(2425835..2427055)
Genome map
AA seq 406 aa AA seqDB search
MLNNRNVLLCVSGGIAVYKACALTSKLVQAGANVKVIMTESACRFVSPLTFQALSRHEVY
TDTFKEQNPSVISHIDAADWADLIIVAPATANVIGKLANGIADDMLTTTLLAATAPVWIA
PAMNVHMYDHPAVKRNISVLYQDGYRFIEPSEGYLACGYVGKGRLEEPENIVKLAEKHFA
EETSAPLEGKHVVITAGPTREAIDPVRFFTNKSTGKMGYALAEAAVQLGARVTLISGPVS
LDQPKGLAEFIPVQSAADMREAVLSVYDASDIVIKTAAVADFTPKTVFDHKMKKQDGGMT
LELKRTVDILKELGEKKKEQILVGFAAETQDIEHYARKKLAAKNLDLIVANDVKANGAGF
GADTNIVTIFFKDGHKRELPIMSKLDVSFEILQEIAALSKQTGERS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
ttgctaaacaatcgaaatgtgttactttgcgtgagcggaggcatcgctgtttataaagcc
tgtgcgttaacgagcaagctggttcaggcaggagcaaatgtcaaagtgattatgactgag
tccgcttgccgattcgtttcaccgctgacatttcaggcattgagccgccacgaagtctat
acagatacatttaaagaacaaaatccaagcgttatttctcatattgatgccgcagactgg
gccgacttgattatcgtagcgccggctacggctaatgtgattggaaaactggcaaacggc
atcgctgatgatatgctgacgacaacattgttggcagcaacggctcccgtttggatcgcg
ccggcgatgaacgttcatatgtatgaccacccggcagtcaaacgaaacatttctgttctt
tatcaggacggttatcgttttattgagccaagtgagggctatttagcatgcggttacgta
ggaaaaggcagattggaagagccggaaaacatcgtaaagctggccgaaaaacattttgct
gaagaaacatccgctcctttagaaggcaagcatgtggtcattacagccggcccaacgcgg
gaagcgattgatcctgtccggttttttaccaataaatcgacgggcaaaatgggctacgca
ctagcggaggctgctgttcagctcggcgcacgggtaaccttaatttctgggcctgtttca
cttgatcagcctaaaggccttgctgagtttatccctgttcaatcggctgcggatatgcgc
gaagctgtgctctctgtgtatgacgcaagcgatatagtcattaaaacagctgcggtagcc
gattttacgccgaaaacagtatttgaccataaaatgaaaaaacaagacggcggcatgacc
ttagaactgaaaagaacagtcgatattttgaaagaattgggcgagaaaaagaaagagcag
attttggtcggatttgccgccgaaacacaagacattgaacactatgcacgtaaaaagctc
gccgctaaaaaccttgatttgattgtggcaaatgatgtgaaagcaaatggggccggtttt
ggtgctgatacgaatatcgtgacaatctttttcaaagacgggcataaacgcgaactcccg
attatgtctaagctcgatgtttcttttgaaatccttcaggagatcgcagccctctcaaaa
caaaccggagagcgctcatga

DBGET integrated database retrieval system