KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_3522Help
Entry
A7A1_3522         CDS       T02384                                 

Definition
(GenBank) Hypothetical protein YlnF
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00860  Porphyrin and chlorophyll metabolism
bsl01100  Metabolic pathways
bsl01110  Biosynthesis of secondary metabolites
bsl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A7A1_3522
Enzymes [BR:bsl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     A7A1_3522
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     A7A1_3522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_7 Sirohm_synth_M Biotin_carb_N
Motif
Other DBs
NCBI-ProteinID: AGA24140
Position
complement(2433817..2434317)
Genome map
AA seq 166 aa AA seqDB search
MEVHMLPLHISLEKKKVVIAGGGSIALRRLKTVISEGADITLVSPDVEPEIKQMAEERRI
KWEKRTIEKEDYLNAFFIIAATDNAAVNKEIAQSASPFQLVNCVSDAELGNVYMPKIVKR
GHVTVSVSTSGASPKHTKELAENVDKLIDGDFVAEVNRLYQMRRKK
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggaggttcatatgcttccgctgcacattagcctggaaaagaagaaggttgtgattgcg
gggggcggaagcatcgctctcagaaggctgaaaacggtgatttctgagggagctgatata
acgcttgtcagtccggatgtggaaccggaaatcaagcaaatggcagaagagcggcgtatc
aaatgggaaaaacggacaattgaaaaagaagattatctcaatgctttcttcattattgct
gcgacggataatgcggcagtgaacaaagaaattgcccaatccgcttcgccttttcagctt
gtcaattgtgtcagtgacgctgagcttggcaatgtatatatgccgaaaatcgtaaaaaga
gggcatgtcactgtgtctgtttctacaagcggagccagtccaaagcacacgaaagagctt
gctgaaaacgtggataagctgattgacggcgattttgttgctgaagtgaacaggctttat
cagatgagaagaaagaaataa

DBGET integrated database retrieval system