KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_3523Help
Entry
A7A1_3523         CDS       T02384                                 

Definition
(GenBank) Sirohydrochlorin ferrochelatase
  KO
K03794  sirohydrochlorin ferrochelatase [EC:4.99.1.4]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00860  Porphyrin and chlorophyll metabolism
bsl01100  Metabolic pathways
bsl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bsl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A7A1_3523
Enzymes [BR:bsl01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     A7A1_3523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CbiX CbiK WAK_assoc
Motif
Other DBs
NCBI-ProteinID: AGA24141
Structure
PDB: 

Position
complement(2434286..2435071)
Genome map
AA seq 261 aa AA seqDB search
MKQAILYVGHGSRVKKAQQEAAAFLEGCKAHISVPVQEISFLELQEPTIETGFEACVKQG
ATHIAVVPLLLLTAAHAKHDIPEEIVRVASRYPSVRISYGKPIGIDEEVVKAVYHRMKDI
GVPYENARVVLIGRGSSDPDVKRDVTGIANLLQEMVPVKEVIPCFLTACGPNYKEVFSEL
KKDDGTTTFIVPYLLFTGMLMNEIEREVQKLKAHNPNVYLSSYIGFHPHVKNAFLNRVRE
TAANSEGQFDFDGGSYASAAH
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaagcaattttatatgtcggccacggcagccgggtcaaaaaagcgcagcaagaa
gccgcagcctttttggaaggatgcaaggcccacatctctgtgccagtacaagaaatcagc
tttttagagcttcaggagccgacaattgagacaggatttgaagcatgtgtgaagcaaggc
gccactcatatcgcagtggtgcctctgcttcttttaacagctgcgcatgcaaaacatgat
attccggaagaaattgtccgtgttgcatctcgatatccatcagtccgcatttcatacgga
aagccgatcgggattgacgaagaagtagtcaaggctgtatatcaccgaatgaaagacata
ggtgttccgtatgaaaatgccagagtggtgctcatcggaaggggaagttcagatccagat
gtcaaaagagacgtaaccggaattgctaatcttcttcaggaaatggttccagtcaaggaa
gtcattccgtgctttttgacagcatgcggccctaattacaaagaggttttttcagaactt
aaaaaagatgacggcacaacaacctttatcgttccatatttgctttttacgggtatgctg
atgaatgaaatcgaacgagaggttcagaaattaaaagcccataatccgaacgtctacctc
tcttcctatatcggttttcatcctcatgtgaaaaacgcatttttgaaccgtgtgagagaa
actgcggcaaattctgagggacaatttgattttgatggaggttcatatgcttccgctgca
cattag

DBGET integrated database retrieval system