KEGG   Bacillus subtilis subsp. subtilis BSP1: A7A1_3625Help
Entry
A7A1_3625         CDS       T02384                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsl  Bacillus subtilis subsp. subtilis BSP1
Pathway
bsl00071  Fatty acid degradation
bsl00072  Synthesis and degradation of ketone bodies
bsl00280  Valine, leucine and isoleucine degradation
bsl00310  Lysine degradation
bsl00362  Benzoate degradation
bsl00380  Tryptophan metabolism
bsl00620  Pyruvate metabolism
bsl00630  Glyoxylate and dicarboxylate metabolism
bsl00640  Propanoate metabolism
bsl00650  Butanoate metabolism
bsl00900  Terpenoid backbone biosynthesis
bsl01100  Metabolic pathways
bsl01110  Biosynthesis of secondary metabolites
bsl01120  Microbial metabolism in diverse environments
bsl01130  Biosynthesis of antibiotics
bsl01200  Carbon metabolism
bsl01212  Fatty acid metabolism
bsl02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A7A1_3625
   00630 Glyoxylate and dicarboxylate metabolism
    A7A1_3625
   00640 Propanoate metabolism
    A7A1_3625
   00650 Butanoate metabolism
    A7A1_3625
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A7A1_3625
   00072 Synthesis and degradation of ketone bodies
    A7A1_3625
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A7A1_3625
   00310 Lysine degradation
    A7A1_3625
   00380 Tryptophan metabolism
    A7A1_3625
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A7A1_3625
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A7A1_3625
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A7A1_3625
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsl04147]
    A7A1_3625
Enzymes [BR:bsl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A7A1_3625
Exosome [BR:bsl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A7A1_3625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGA24243
Structure
PDB: 

Position
1687160..1688341
Genome map
AA seq 393 aa AA seqDB search
MRKTVIVSAARTPFGKFGGVLKEVKAAELGGIVMKEALQRAGVSGDDVEGNVMGMVVQAG
SGQIPSRQAARLAGMPWSVPSETLNKVCASGLRAVTLCDQMIRAQDADILVAGGMESMSN
IPYAVPAGRWGARMGDGELRDLMVYDGLTCAFDEVHMAVHGNTAAKEYAISRREQDEWAL
RSHARAAKAADEGKFQDEIVPVNWIGRKGKPNVVDKDEAIRRDTSLDQLAKLAPIFASDG
SITAGNAPGVNDGAGAFVLMSEEKAAELGKRPLATILGFSTTGMPAHELAAAPGFAINKL
LKKNGLTVQDIDLFEVNEAFASVVLTCEKIVGFDLEKVNVNGGAIALGHPIGASGARILM
TLVYELKRRGGGLGVAAICSGAAQGDAVLVQVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaacagtcattgtaagtgctgcaagaacgccatttggcaaatttggcggagta
ttgaaagaggtgaaagctgctgagcttgggggcattgtgatgaaggaggcgctgcaacgg
gctggagtctctggagatgatgtagaaggaaacgtcatgggcatggttgtccaggccggc
tcagggcagataccttcccgtcaagctgcccgtctggcgggaatgccttggagtgtgccg
tcagaaacactgaataaagtctgtgcttccggccttcgcgctgtcactttatgtgatcaa
atgattcgggcgcaggatgcggacatacttgttgcgggggggatggaaagcatgagcaat
attccgtatgccgttcccgccgggcgctggggagcacggatgggagacggcgagcttagg
gacttaatggtgtatgacggattaacgtgcgcatttgacgaggtgcacatggctgttcac
ggaaatacagctgccaaggaatatgcaatctcacgaagagagcaggacgaatgggcgttg
agaagtcatgcaagggcagctaaggccgccgatgaagggaagtttcaggatgaaattgtt
cccgtcaactggatcggccgaaaaggaaaaccaaacgttgttgataaagatgaagcgatt
cgccgtgacacaagtctggatcagctcgcgaaacttgctccgatttttgcaagtgacggt
tctatcacagccggcaatgctcccggggtcaatgacggagccggcgcgttcgtgctgatg
tctgaggaaaaagctgctgagcttggcaaacggcctctggctacaattcttggtttttca
actacgggaatgccagcgcacgagctggcggcagcgccggggtttgccattaacaagctc
ctgaaaaagaacggtttgactgtccaagatattgacttgtttgaagtaaatgaagctttt
gcttcagttgttttgacatgtgaaaaaatcgtaggtttcgatcttgaaaaagtaaatgtg
aatggcggtgcgatcgcgctcggccacccgatcggcgcgagcggggcgagaattctcatg
acgcttgtttatgaattaaagcgccggggagggggtctgggcgttgccgctatttgcagc
ggggcagcacagggagacgccgtcttagtgcaggttcattaa

DBGET integrated database retrieval system