KEGG   Bacillus smithii: BSM4216_1151Help
Entry
BSM4216_1151      CDS       T03984                                 

Definition
(GenBank) 2,3-butanediol dehydrogenaseR-alcohol forming R and S-acetoin-specific
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bsm  Bacillus smithii
Pathway
bsm00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSM4216_1151
Enzymes [BR:bsm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BSM4216_1151
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BSM4216_1151
    1.1.1.-  
     BSM4216_1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N ADH_N_assoc ADH_zinc_N_2 2-Hacid_dh_C F420_oxidored NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AKP46451
UniProt: A0A0H4NX81
Position
1:992916..993968
Genome map
AA seq 350 aa AA seqDB search
MKGARWHNVRDIRVEEVEEPKVEKGKVKIQVEWAGICGSDLHEYVAGPIFIPVKEPHPIS
KDVAPIIMGHEFSGRVVEVGEGVTKVKVGDPVVVEPILRCGKCPACKQGKYNLCENLGFH
GLAGGGGGFSEYTVVDEYMVHKMPEGLSFEQGALVEPAAVALHAVRSSKIKAGDKAAVFG
TGPIGLLVIEALKAAGASEIYAVEVSEERLQKALELGATVVINPKNEDPVQKLLELTDGG
VDVSFEVTGVPAVLQQAVDSTAFEGETVIVSIWEKEANLLPNNIVLKERNVKGVIAYRDI
FPAVMNLMKQGYFPAEKLVTKKIKLDQIVEEGFEKLIKEKDQVKILVKPE
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtgcaagatggcataacgttcgcgacattcgagtggaggaagtggaagaaccg
aaagtagaaaaaggaaaagtaaaaatccaagtggaatgggcaggaatctgcggcagtgat
ttgcatgaatacgttgccggtcctatttttattcctgtcaaagaacctcatcctatcagt
aaagatgtagctcctatcattatgggacacgaattttcgggacgagtagtggaagtgggc
gaaggagttacgaaagtaaaagtaggagatcctgtcgttgtagaacccattcttcgctgt
ggaaaatgtcctgcatgtaaacaaggaaaatacaatctctgcgaaaatttaggattccac
ggtttagccggaggaggcggtggattctctgaatatactgtagtagatgaatacatggtt
cataaaatgccagaaggcctttctttcgaacaaggggcacttgtggaaccggcagctgta
gctttacacgccgtaagatcgagcaaaattaaggccggtgataaagcggctgtctttgga
acaggtccaatcgggcttcttgtcattgaagctttaaaagcagccggtgcttccgaaata
tatgccgtagaagtttccgaagaacgtcttcaaaaagcgttggaactcggcgcaactgtt
gtcatcaatccgaaaaatgaagatcccgtccaaaagcttctcgaactgaccgatggaggc
gtcgatgtttcctttgaagtaacaggagtgccggctgttttacaacaagccgttgacagt
acggcgttcgaaggagaaacagtgatcgttagtatttgggaaaaagaagcgaaccttttg
cccaataacatcgttttaaaagaaagaaacgtaaagggagtcattgcataccgcgatatc
ttcccggcagtcatgaatttaatgaaacaaggttatttcccagctgaaaagcttgtaacg
aaaaaaattaaactggatcaaattgtagaagaaggatttgaaaaactcatcaaagaaaaa
gatcaagtgaaaattttagtcaaaccagaataa

DBGET integrated database retrieval system