KEGG   Bacillus smithii: BSM4216_1246Help
Entry
BSM4216_1246      CDS       T03984                                 

Definition
(GenBank) Thiaminase II
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
bsm  Bacillus smithii
Pathway
bsm00730  Thiamine metabolism
bsm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BSM4216_1246
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsm03000]
    BSM4216_1246
Enzymes [BR:bsm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     BSM4216_1246
Transcription factors [BR:bsm03000]
 Prokaryotic Type
  Other transcription factors
   Others
    BSM4216_1246
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: AKP46528
UniProt: A0A0H4P261
Position
1:1064545..1065225
Genome map
AA seq 226 aa AA seqDB search
MMKFSKRLYEKIQPIWRKNHSHPFVQEMGDGSLDPRKFRFYMIQDYLYLIQYSKLFALGA
VKADDVETMGKFSALLHSTINEEMSLHRQYAKRFDICEEELEKAKPSSTTLAYTHYMLHV
GQNGTLAELVSAILPCMWSYWEIGKELSRLPGASDHELYGEWIQMYSSEEFGELAQWCIH
LLDDLAAGKQESELARLEEIFLNTTRFEYMFWEMAYNEEMWPTERE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatttagtaaaagattatacgaaaaaatacaacctatttggagaaagaatcat
tctcatccctttgtacaggaaatgggagatggctctcttgatccaagaaaatttcgattt
tatatgattcaagactacctatacttgattcaatattccaaattatttgcattgggtgcc
gttaaggctgatgatgtagaaacaatggggaaattttcagcgcttttgcattccaccatc
aatgaggagatgtctcttcaccgccaatatgcgaaacgatttgacatttgcgaagaggag
cttgaaaaagccaaaccttcttccactacactggcttatacgcattatatgctgcatgtc
ggccaaaatggtacgcttgcggaacttgtatccgctatacttccttgtatgtggagctat
tgggagattggtaaagaattaagccgtttgccgggggctagtgatcatgaactttatgga
gaatggattcaaatgtacagctcggaggaatttggagaactcgctcaatggtgtatccat
cttctcgatgatcttgcagcaggaaaacaagaatcagaacttgcgagactggaagaaatt
ttcttgaacacgactcgatttgaatacatgttttgggagatggcttacaacgaggaaatg
tggccaactgaacgggaatga

DBGET integrated database retrieval system