KEGG   Bacillus smithii: BSM4216_1443Help
Entry
BSM4216_1443      CDS       T03984                                 

Definition
(GenBank) Pyruvate carboxyl transferase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
bsm  Bacillus smithii
Pathway
bsm00020  Citrate cycle (TCA cycle)
bsm00620  Pyruvate metabolism
bsm01100  Metabolic pathways
bsm01120  Microbial metabolism in diverse environments
bsm01200  Carbon metabolism
bsm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BSM4216_1443
   00620 Pyruvate metabolism
    BSM4216_1443
Enzymes [BR:bsm01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     BSM4216_1443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA CPSase_L_D2 Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl ATP-grasp Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp_3 HlyD_D23 RnfC_N HlyD_3 ATPgrasp_Ter ATP-grasp_4 NQRA GCV_H ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AKP46724
UniProt: A0A0H4NYW4
Position
1:1244594..1248034
Genome map
AA seq 1146 aa AA seqDB search
MMKKIEKVLVANRGEIAIRVFRACTELNIRTVAIYSKEDSGSYHRYKADEAYLVGEGKKP
IDAYLDIEGILEIAKNAEVDAIHPGYGFLSENIEFARRCEEEGIIFIGPRTEHLDMFGDK
VKARKQAQRAGIPVIPGSDGPVSGYEEIEAFGEKYGYPIIIKAALGGGGRGMRIVHSSEE
VKEAYERAASEAKAAFGSSEVYVEKFVQNPKHIEVQILGDKEGNIIHLYERDCSVQRRHQ
KVVEVAPCVSLSDELREKICEAAVQLMKNVQYENAGTVEFLVSGENFYFIEVNPRIQVEH
TITELITGIDIVQTQIMIAKGYSLHSEKIGIPKQENIHLNGYAIQSRVTTEDPTNNFMPD
TGKIMAYRSGGGFGVRLDAGNGFQGAVITPYYDSLLVKVSTWALTFEQAAAKMVRNLQEF
RIRGIKTNIPFLENVMKHEKFLSGNYDTSFLDTTPELFIFPKRKDRGTKMLNYIGTITVN
GFPGIEKKKKPVFDKPRIPKIKHYEEIQSGTKQILDKEGPDGLVKWVKNQKNLLLTDTTF
RDAHQSLLATRVRTNDLVRIAEPTARLLPNLFSLEMWGGATFDVAYRFLKEDPWDRLLQL
RKEIPNILFQMLLRASNAVGYKNYPDNVIREFVAKSADAGIDVFRIFDSLNWVKGMEVAI
DAVRQSGKIAEAAICYTGDIDDPTRTKYDIQYYKHLAKELENQGAHILGIKDMAGLLKPQ
SAYRLISELKETVDIPIHLHTHDTSGNGIYMYAKATEAGVDIVDVALSSMAGLTSQPSAN
TLYYALKGTEREPVVNVEGLEQLSRYWEDVRKYYKDFESGMVAPHTEVYQHEMPGGQYSN
LQQQAKAVGLGDRWDEVKEMYHRVNMMFGDIVKVTPSSKVVGDMALFMVQNDLSEEDVLE
KGETIDFPDSVVEFFQGYLGQPYGGFPEKLQKVILKEKEPITVRPGELLESVDFKALRDE
LFHELGRQVTAHEVIAYALYPKVFLDYIQAVEKYGDLSVLDTPTFLYGMRLGEEIEVEIE
RGKTLIVKLVSIGQAQADGTRIVYFELNGQPREVVIKDESIKSTVATRVKADLKNKNHIA
ATMPGTVMKVIVSKGEKVKKGDHLMITEAMKMETTVQAPFSGVVKDIYVKSGDAISTGDL
LIELQK
NT seq 3441 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaagattgagaaagtgcttgtcgccaataggggtgaaattgccattcgcgtc
tttcgggcatgcacagaattaaatattcgaacggtggccatctattcaaaagaagactcc
ggttcttaccatcgttataaagcggatgaagcttatttagtcggtgaaggaaaaaagccg
atagacgcttatttagatatagaagggatactggaaattgcgaagaacgcagaagtggat
gccattcatccaggctacggttttttatctgaaaatattgaatttgcaagaagatgcgaa
gaagaaggaattattttcataggtccgcggaccgaacatttggatatgtttggcgacaaa
gtaaaagccagaaaacaagcgcagcgagcaggaattcctgttattccaggaagcgatgga
cctgtttccggctatgaagagattgaagcgtttggggaaaaatatggttacccgatcatc
attaaagcagcattaggcggcggcggacgcggtatgcgaattgttcatagcagtgaagaa
gtgaaagaagcttacgaacgagctgcgtcggaagcgaaagccgcatttggcagcagtgaa
gtctatgttgaaaaatttgtccaaaatccgaaacatatcgaagtccaaattcttggagat
aaagaaggaaatatcattcatctgtatgaacgcgattgctccgtacagcgccggcatcag
aaagtagtcgaagtggctccttgcgtttctttatcggatgaacttcgcgaaaaaatttgt
gaagcagctgtgcagttaatgaaaaacgttcaatacgaaaatgcaggtacggtcgaattt
ttagtttcgggcgaaaatttttactttattgaagtaaacccgcgcattcaagtagaacat
accatcactgaactgatcacgggcatcgatattgtacaaacccaaattatgattgcgaaa
gggtactcgttacatagtgaaaaaatagggattccaaaacaagaaaacattcatcttaat
ggatatgccattcaatcacgtgtgacaacagaagatccaacgaacaattttatgccggat
acaggaaaaatcatggcttatcgatccggtggagggtttggagtacgattagatgcagga
aatgggtttcaaggagcagtcattacaccttattacgactcgctattagtgaaagtgtct
acttgggctctaacatttgagcaagcggctgcaaaaatggttcgaaaccttcaagaattc
agaattcgcggaatcaaaacaaatattccatttttggaaaatgtcatgaaacacgaaaaa
tttctgtcagggaattacgacacgtcttttttagatacaacacctgaattatttattttt
ccaaaaagaaaagaccgtggcaccaaaatgttaaactacatcggaacgatcaccgtcaac
ggattcccgggcattgaaaaaaagaaaaaaccggtatttgacaaacctcggatccctaaa
attaagcattacgaggaaatacagtcagggacaaaacaaattctggacaaagaagggccg
gacggacttgtcaaatgggtgaaaaatcaaaagaatttgttgttgacagataccactttc
cgcgatgctcatcaatcgcttttggcaactcgggtaagaacgaatgaccttgttcgcatt
gccgaaccaacagcacgactgctccctaatttgttttcattggaaatgtggggaggagct
acctttgatgtcgcctatcggtttttgaaagaagacccgtgggatcgattgctgcaattg
aggaaagaaattcccaatattttatttcaaatgctgttaagagcatcgaatgcagtcggt
tataaaaattatcctgacaatgtcatccgtgaatttgtagcaaaatctgcagatgcagga
attgatgttttccgaatttttgatagcctcaactgggttaaagggatggaagtagccatt
gatgcagttcgacaatccgggaaaattgcggaagcagccatatgttatacgggggatata
gatgatccgactcgaacgaagtacgatattcaatattacaaacatcttgctaaagagctt
gaaaatcaaggcgctcacattctcggcattaaagatatggccggcttattaaaaccgcaa
tccgcttacagattaatttctgaattgaaggaaacggtggatattcccattcatttgcat
acgcatgatacgagcggaaacggcatttatatgtacgccaaggcaacagaagcaggagtc
gatattgtggatgtagcgctcagttctatggctggtttgacatcacagccaagcgcgaat
accttatactatgcgctaaaagggacggaaagagaacccgttgtgaatgtggaagggctt
gaacaactttcccgatattgggaagacgtacgcaaatattacaaagacttcgaaagcggc
atggtggcgccgcatacagaagtttaccagcacgaaatgcccggaggccagtacagcaac
cttcaacaacaagcaaaagcagttggtcttggagatcgctgggatgaagtgaaagaaatg
taccatcgggttaatatgatgtttggcgatattgtgaaagtgactccttcttcgaaagta
gtgggagatatggctttatttatggtgcaaaatgatctttcggaagaagatgtgttggaa
aagggtgaaacgatcgatttccctgattctgttgttgaatttttccaaggatatctcgga
cagccatatggaggatttcctgaaaaactgcaaaaagtcatcttaaaagagaaagaaccc
attaccgtcagacctggtgaattgctcgaaagcgtcgatttcaaagctttaagggatgaa
ctattccatgaacttggacgccaagtaaccgctcatgaagtgatagcctacgcattatat
ccaaaagtatttttggattatattcaagctgtggaaaaatatggcgacctatctgttctc
gatacaccgactttcctttacggtatgagattaggagaagaaattgaagtagaaattgaa
agaggtaaaacgttgattgtcaagctggtatccatcggccaagcccaagcagacggcacc
agaattgtctattttgaattgaatggccagcctcgtgaagtggtcatcaaagatgaaagc
attaaatcaacagtcgctacaagagtaaaagcagacttgaaaaataaaaaccatatcgct
gcaacgatgccgggtacggtgatgaaagttattgtttcgaaaggggaaaaagttaaaaaa
ggcgaccatttaatgataacggaagcaatgaaaatggaaacgacggttcaagctcctttt
tccggcgttgtgaaagatatttatgtaaaaagcggcgatgccatttcaacaggtgattta
ctgattgagctgcaaaaataa

DBGET integrated database retrieval system