KEGG   Bacillus smithii: BSM4216_3706Help
Entry
BSM4216_3706      CDS       T03984                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsm  Bacillus smithii
Pathway
bsm00071  Fatty acid degradation
bsm00072  Synthesis and degradation of ketone bodies
bsm00280  Valine, leucine and isoleucine degradation
bsm00310  Lysine degradation
bsm00362  Benzoate degradation
bsm00380  Tryptophan metabolism
bsm00620  Pyruvate metabolism
bsm00630  Glyoxylate and dicarboxylate metabolism
bsm00640  Propanoate metabolism
bsm00650  Butanoate metabolism
bsm00900  Terpenoid backbone biosynthesis
bsm01100  Metabolic pathways
bsm01110  Biosynthesis of secondary metabolites
bsm01120  Microbial metabolism in diverse environments
bsm01130  Biosynthesis of antibiotics
bsm01200  Carbon metabolism
bsm01212  Fatty acid metabolism
bsm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSM4216_3706
   00630 Glyoxylate and dicarboxylate metabolism
    BSM4216_3706
   00640 Propanoate metabolism
    BSM4216_3706
   00650 Butanoate metabolism
    BSM4216_3706
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSM4216_3706
   00072 Synthesis and degradation of ketone bodies
    BSM4216_3706
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSM4216_3706
   00310 Lysine degradation
    BSM4216_3706
   00380 Tryptophan metabolism
    BSM4216_3706
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSM4216_3706
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSM4216_3706
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSM4216_3706
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsm04147]
    BSM4216_3706
Enzymes [BR:bsm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSM4216_3706
Exosome [BR:bsm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSM4216_3706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III FAE1_CUT1_RppA SpoVAD
Motif
Other DBs
NCBI-ProteinID: AKP48861
UniProt: A0A0H4P405
Position
1:complement(3237287..3238474)
Genome map
AA seq 395 aa AA seqDB search
MVKTVIVEGARTPIGKLGGSLRSLTAPELGAVAMKEAMLRANVQPAEVDEVIIGTVLQGG
QGQLPSRQAARKAGIPWNVKTETINKVCASGIRSITLADQIIRAGDGEVVVAGGMESMSN
APYVLQNVRSGLRMGDDKLVDLMIYDGLTCAFSGVHMGTFGNKTGKELGISREEQDEWAY
RSHQLAIKAMEEGKFAEEIVPVEVPQPKGEPVLVSDDEAPRKDTSIEKLAKLKPAFDRDG
TITAGNAPGVNDGAAALVLMSEERAEKEGKNILARIIAHEAVAVEAENFPKTPGLVINEL
LKKTGKSIDDIDLFEINEAFAVVALASSQIAGIDLDRINVNGGAVALGHPIGASGARIVL
TLAYELRRRGGGIGVAAICSGGGQGDAVMIDVPKQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaacagtgattgttgagggagcaaggacgccgatcggaaaacttggagggagt
ttacgttctttaacggctcccgaacttggagcggtcgcgatgaaagaagcgatgcttcga
gcaaatgttcaaccggcggaagtcgatgaggtgatcatcgggaccgttcttcaaggagga
caggggcagcttccgtccagacaggccgcgagaaaagcgggaattccttggaacgtcaaa
acggaaacgatcaataaagtctgcgcatcaggaataagaagcatcacattggcggaccaa
atcattcgtgcgggagacggagaagtagtggtagcaggcggaatggagtcgatgtccaat
gctccttacgttttgcaaaacgtccgttccggcttgagaatgggcgatgacaaattggtg
gatttaatgatctatgatggtttaacgtgcgccttttcaggagtccatatgggtacgttc
ggaaacaagaccggaaaagaactgggcatttcccgcgaagaacaagatgaatgggcttat
cgcagccatcagttggccattaaggcaatggaggaaggaaagtttgccgaggaaattgtt
cctgtcgaagtcccgcagccaaaaggcgaaccggtgttggtgtccgatgatgaagcgccg
cgtaaagatacgtccattgagaagctggccaaattaaagccggcttttgatcgagacgga
acgatcacggcgggaaatgctccgggtgtaaatgatggagcggcggctctggttctgatg
agcgaagagcgcgccgaaaaagaaggcaaaaacatccttgctcggattattgctcatgag
gctgtggcggtagaggcggaaaattttccgaaaactcccggattggtcattaatgagctt
ttgaaaaaaaccggaaaatcaattgatgacatcgatttatttgagattaatgaagctttt
gccgtagtggcgctggcaagcagtcaaatagccgggatcgatctcgatagaatcaatgtc
aatggcggggcggttgctctcggccacccgatcggggcaagcggagcacggatagttctc
acgttggcatacgagttaagaagaagaggcggcggaataggagtggcggccatttgcagc
ggcgggggtcaaggtgatgccgttatgattgacgttcccaaacaataa

DBGET integrated database retrieval system