KEGG   Bacillus subtilis BSn5: BSn5_00440Help
Entry
BSn5_00440        CDS       T01417                                 

Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00040  Pentose and glucuronate interconversions
bsn00052  Galactose metabolism
bsn00500  Starch and sucrose metabolism
bsn00520  Amino sugar and nucleotide sugar metabolism
bsn01100  Metabolic pathways
bsn01130  Biosynthesis of antibiotics
Module
bsn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BSn5_00440
   00052 Galactose metabolism
    BSn5_00440
   00500 Starch and sucrose metabolism
    BSn5_00440
   00520 Amino sugar and nucleotide sugar metabolism
    BSn5_00440
Enzymes [BR:bsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BSn5_00440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: ADV92724
Position
72692..73585
Genome map
AA seq 297 aa AA seqDB search
MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAAESGIEDILIITGR
NKRSIEDHFDRSAELEFNLREKGKTETLKEMQQIADLANIHYIRQKEPLGLGHAVLCAEH
FIGDEPFAVLLGDDIMVSETPALRQLMDVYDVYGTEVVGVQSVLPEDVSKYGIINTSGSQ
GHVYEVNDLVEKPSPEEAPSEIAVMGRYVLNSSIFSVLKTIGRGAGNEIQLTDALREVCR
KEPIHARLLEGNRYDIGDKLGCFKASTEIGLMRSEMRSQLLAYLEDVIKRETKEMLR
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagtgagaaaagcagttattcccgcagcgggtttaggaacgagatttctg
ccggcgacaaaggcgcagcctaaagaaatgctcccaatcgtcgacaaaccagcaatccaa
tatattgtagaagaggccgcagagtcaggaattgaagatatactgattattacagggaga
aacaaacgctcgattgaagatcattttgatcggtcggcggaattggaattcaatctccgg
gaaaaaggcaagacggagacacttaaggaaatgcagcagattgccgatttggccaacatt
cattacatccgccagaaagaaccgctcggattaggccatgcggtgctgtgtgcggagcat
tttatcggagatgagccttttgccgttctcttaggtgatgatattatggtgtctgaaaca
ccggctcttcggcaattaatggatgtatatgacgtttatggcacagaggttgtcggtgta
cagtcagttctccctgaggatgtcagcaaatatggtattataaatacatcagggtctcaa
gggcatgtatatgaagtgaacgatttagtggaaaagccttctcctgaagaagcaccttcg
gaaatcgcagtaatgggacgttatgtgctgaattcttcgatcttctccgttttgaagaca
attggcagaggcgcgggcaacgaaattcagctgacagatgcgcttcgtgaggtttgccgt
aaggagccgatccatgcccggctgctggaaggaaatcgatatgacattggcgataagcta
ggctgttttaaagcgagcaccgaaatcggcttaatgcgttccgaaatgagatctcagctt
ttggcctatttagaagatgtgatcaaacgggaaacgaaagaaatgctgcggtaa

DBGET integrated database retrieval system