KEGG   Bacillus subtilis BSn5: BSn5_04425Help
Entry
BSn5_04425        CDS       T01417                                 

Definition
(GenBank) putative AdoMet-dependent methyltransferase
  KO
K17462  putative AdoMet-dependent methyltransferase [EC:2.1.1.-]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00270  Cysteine and methionine metabolism
bsn01100  Metabolic pathways
bsn01230  Biosynthesis of amino acids
Module
bsn_M00609  Cysteine biosynthesis, methionine => cysteine
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSn5_04425
Enzymes [BR:bsn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     BSn5_04425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_23 Methyltransf_12 RrnaAD Methyltransf_31 Ubie_methyltran CMAS Methyltransf_28 DUF2383
Motif
Other DBs
NCBI-ProteinID: ADV93513
Position
complement(796228..796869)
Genome map
AA seq 213 aa AA seqDB search
MGREFIPLFEDWAATYDQTVQGLDIQYKEAFRGYDHILDAIVSKSGTHVLEFGPGTGNLT
AKLLDAGKTVFGIEPSPAMRKLASDKLSGRSEIVDGDFLTFPEPPFQADTIVSSYAFHHL
TDEEKRAAIKQYGKYLHLHDKIVFADTVFENAQAYQQAIDKARSQGFYQLANDLETEHYP
TLDALKEMFTAEGFAVRFTQQNDFVWIMEAIKR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgggacgtgaatttatccctctctttgaagattgggcagcaacttatgatcaaacagta
caaggtttagatattcagtataaagaagcgttcagaggctacgatcatatccttgatgcc
atcgtcagcaaatctggaacgcatgtgttagaatttggcccggggacagggaatttgacg
gctaagctgctcgatgcaggcaaaactgtatttggaatcgaaccttctccagcaatgcgt
aaactggcttctgacaagctttcaggcaggtcggaaatcgttgatggagacttcctgaca
ttccctgaaccgccatttcaggctgatacaattgtcagttcatatgcttttcatcatttg
actgacgaagaaaagcgggctgccataaagcaatatggcaaataccttcacttgcatgat
aaaatagtgtttgccgataccgtctttgaaaatgcgcaagcgtatcaacaggctatcgat
aaagcccgttctcaaggcttttatcagcttgcaaatgatttagagacagagcattatcct
acattggatgcgttgaaagaaatgtttacagctgaaggttttgcagtccgattcactcag
caaaacgacttcgtgtggataatggaggcgatcaaacggtaa

DBGET integrated database retrieval system