KEGG   Bacillus subtilis BSn5: BSn5_04975Help
Entry
BSn5_04975        CDS       T01417                                 

Definition
(GenBank) acetolactate synthase catalytic subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00290  Valine, leucine and isoleucine biosynthesis
bsn00650  Butanoate metabolism
bsn00660  C5-Branched dibasic acid metabolism
bsn00770  Pantothenate and CoA biosynthesis
bsn01100  Metabolic pathways
bsn01110  Biosynthesis of secondary metabolites
bsn01130  Biosynthesis of antibiotics
bsn01210  2-Oxocarboxylic acid metabolism
bsn01230  Biosynthesis of amino acids
Module
bsn_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bsn_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSn5_04975
   00660 C5-Branched dibasic acid metabolism
    BSn5_04975
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BSn5_04975
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSn5_04975
Enzymes [BR:bsn01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     BSn5_04975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M DXP_synthase_N CO_dh
Motif
Other DBs
NCBI-ProteinID: ADV93623
Position
complement(903783..905507)
Genome map
AA seq 574 aa AA seqDB search
MGTNVQVDSASAECTQTMSGALMLIESLKKEKVEMIFGYPGGAVLPIYDKLYNSGLVHIL
PRHEQGAIHAAEGYARVSGKPGVVIATSGPGATNLVTGLADAMIDSLPLVVFTGQVATSV
IGSDAFQEADILGITMPVTKHSYQVRQPEDLPRIIKEAFHIATTGRPGPVLIDIPKDVAT
IEGEFSYDHEMNLPGYQPTTEPNYLQIRKLVEAVSSAKKPVILAGAGVLHGKASEELKNY
AEQQQIPVAHTLLGLGGFPADHPLFLGMAGMHGTYTANMALHECDLLISIGARFDDRVTG
NLKHFARNAKIAHIDIDPAEIGKIMKTQIPVVGDSKIVLQELIKQDGKQSDSSEWKKQLA
EWKEEYPLWYVDNEEEGFKPQKLIEYIHQFTKGEAIVATDVGQHQMWSAQFYPFQKADKW
VTSGGLGTMGFGLPAAIGAQLAEKDATVVAVVGDGGFQMTLQELDVIRELNLPVKVVILN
NACLGMVRQWQEIFYEERYSESKFASQPDFVKLSEAYGIKGIRISSEAEAKEKLEEALTS
REPVVIDVRVASEEKVFPMVAPGKGLHEMVGVKP
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggggactaatgtacaggtggattcagcatctgccgaatgtacacagacgatgagcgga
gcattaatgctgattgaatcattaaaaaaagagaaagtagaaatgatcttcggttatccg
ggcggggctgtgcttccgatttacgataagctatacaattcagggttggtacatatcctt
ccccgtcacgaacaaggagcaattcatgcagcggagggatacgcaagggtctccggaaaa
ccgggtgtcgtcattgccacgtcagggccgggagcgacaaaccttgttacaggtcttgct
gatgccatgattgattcattgccgttagttgtctttacagggcaggtagcaacctctgta
atcgggagcgatgcatttcaggaagcagacattttagggattacgatgccagtaacaaaa
cacagctaccaggttcgccagccggaagatctgccgcgcatcattaaagaagcgttccat
attgcaacaactggaagacccggacctgtattgattgatattccgaaagatgtagcaacg
attgaaggagaattcagctacgatcatgagatgaatctcccgggataccagccgacaaca
gagccgaattatttgcagatccgcaagcttgtggaagccgtgagcagtgcgaaaaaaccg
gtgatcctggcgggtgcgggcgtactgcacggaaaagcgtcagaagaattaaaaaattat
gctgaacagcagcaaatccctgtggcacacacccttttggggctcggaggcttcccggct
gaccatccgcttttcctggggatggcgggaatgcacggtacttatacagccaatatggcc
cttcatgaatgtgatctattaatcagtatcggcgcccgttttgatgaccgtgtcacagga
aacctgaaacactttgccagaaacgcaaagattgcccacatcgatattgatccagctgaa
atcggaaaaatcatgaaaacacagattcctgtagtcggagacagcaaaattgtcctgcag
gagctgatcaaacaagacggcaaacaaagcgattcaagcgaatggaaaaaacagctcgcc
gaatggaaagaagagtatccgctctggtatgtagataatgaagaagaaggttttaaacct
cagaaattgattgaatatattcatcaatttacaaaaggagaggccattgtcgcaacggat
gtaggccagcatcaaatgtggtcagcgcaattttatccgttccaaaaagcagataaatgg
gtcacgtcaggcggacttggaacgatgggattcggtcttccggcggcgatcggcgcacag
ctggccgaaaaagatgctactgttgtcgcggttgtcggagacggcggattccaaatgacg
cttcaagaactcgatgttattcgcgaattaaatcttccggtcaaggtagtgattttaaat
aacgcttgtctcggaatggtcagacagtggcaggaaattttctatgaagaacgttattca
gaatctaaattcgcttctcagcctgacttcgtcaaattgtccgaagcatacggcattaaa
ggcatcagaatttcatcagaagcggaagcaaaggaaaagctggaagaggcattaacatca
agagaacctgttgtcattgacgtgcgggttgccagcgaagaaaaagtattcccgatggtg
gctccggggaaagggctgcatgaaatggtgggggtgaaaccttga

DBGET integrated database retrieval system