KEGG   Bacillus subtilis BSn5: BSn5_05490Help
Entry
BSn5_05490        CDS       T01417                                 

Definition
(GenBank) RNA-binding riboflavin kinase
  KO
K00861  riboflavin kinase [EC:2.7.1.26]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00740  Riboflavin metabolism
bsn01100  Metabolic pathways
bsn01110  Biosynthesis of secondary metabolites
Module
bsn_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BSn5_05490
Enzymes [BR:bsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     BSn5_05490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavokinase
Motif
Other DBs
NCBI-ProteinID: ADV93726
Position
complement(1009496..1010188)
Genome map
AA seq 230 aa AA seqDB search
MTIIAGTVVKGKQLGRKLGFPTANVDAKMHGLRNGVYGVLATVNHQFHLGVMNIGVKPTV
GSNLEKTLEIFLFDFHRDIYGEKIECSILFKIREERRFDALESLTKQIKKDISCVAKRFE
LIGIMAPNKKESLLSHQELNLPDLCFYKKCNNLYCVNRGVYNVIDNWFFEYGITQVAYRR
IYILSFLSFLKEDNPKVSSKYIRFGAGGLADKLNRFISSYVEESEENILG
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
ttgacgatcattgccggtacggttgtgaaaggaaaacaattaggcagaaagcttggattc
cccacggcaaatgtagatgcaaaaatgcatgggctgcgtaatggagtttatggggttctg
gcgacagtcaatcatcaatttcatttaggggttatgaatatcggtgtgaaaccgacggtg
ggctctaaccttgaaaagacattggagatttttttgtttgactttcatagagacatttat
ggagaaaaaatcgaatgcagcattctctttaaaattagagaagaaagaaggtttgatgct
ttggagtcgttaacaaagcaaattaaaaaggatatttcgtgcgttgcaaaacgctttgag
ctgattgggattatggcaccgaataaaaaagaaagcctgctttcccatcaggagttaaat
cttccggatctctgtttttacaagaaatgtaataacctatattgcgtcaaccgaggcgta
tacaatgtcattgataactggttttttgagtacggaattacacaagtagcttacaggcgc
atttatattttatcttttttaagctttttgaaagaagataatccgaaagtttccagcaag
tatataagatttggggcgggcggtcttgctgataaattgaaccgatttatttcatcttat
gttgaagagtctgaagaaaatatattgggatag

KEGG   Bacillus subtilis BSn5: BSn5_20450Help
Entry
BSn5_20450        CDS       T01417                                 

Definition
(GenBank) bifunctional riboflavin kinase/FMN adenylyltransferase
  KO
K11753  riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00740  Riboflavin metabolism
bsn01100  Metabolic pathways
bsn01110  Biosynthesis of secondary metabolites
Module
bsn_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BSn5_20450
Enzymes [BR:bsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.26  riboflavin kinase
     BSn5_20450
   2.7.7  Nucleotidyltransferases
    2.7.7.2  FAD synthetase
     BSn5_20450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_syn Flavokinase CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: ADV96694
Position
3948323..3949273
Genome map
AA seq 316 aa AA seqDB search
MKTIHITHPHHLIKEEQAKSVMALGYFDGVHLGHQKVIGTAKQIAEEKGLTLAVMTFHPH
PSHVLGRDKEPKDLITPLEDKINQIEQLGTEVLYVVKFNEVFASLSPKQFIDQYIIGLNV
QHAVAGFDFTYGKYGKGTMETMPDDLDGKAGCTMVEKLTEQDKKISSSYIRTALQNGDVE
LANVLLGQPYFIKGIVIHGDKRGRTIGFPTANVGLNNSYIVPPTGVYAVKAEVNGEVYNG
VCNIGYKPTFYEKRPEQPSIEVNLFDFDQEVYGAAIKIEWYKRIRSERKFNGIKELTEQI
EKDKQEAIRYFSNLRK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacgatacatattacacatcctcatcatttaataaaagaggagcaggcaaaatca
gtgatggcgttaggatattttgacggcgttcatctcgggcatcaaaaggtaatcggcaca
gcgaagcaaatagccgaagaaaaaggtctgacattggctgtgatgacctttcatccccat
ccttctcacgtgttgggcagagataaggaacctaaggatctgattacgcctcttgaagac
aaaataaatcaaattgaacaattaggtacagaagttctgtatgtcgttaaatttaatgaa
gtgtttgcttctctttctcctaagcagtttatagaccagtatattatcggccttaatgta
cagcacgcagtggcaggctttgactttacgtacggcaaatacggcaagggaacaatggag
accatgccggatgatttagacggaaaagctgggtgcacaatggtagaaaaattgacggag
caggataaaaaaatcagttcttcgtatatccgtaccgcgcttcaaaacggagatgttgaa
ttggcgaatgtcttgcttggacagccatattttattaaaggaattgtcattcatggtgat
aaaagagggcggaccatcggttttccgacagcgaatgtcggtttaaataacagctatatc
gttccgcccacaggtgtatatgccgtaaaagcggaagtgaacggcgaagtttacaatggc
gtttgcaatattggctataagccgacgttttatgaaaagcgccctgagcagccttccatc
gaggtcaatctgtttgatttcgatcaggaggtatatggagccgctataaaaatcgaatgg
tacaaacggattcggagcgagcggaaattcaatggcatcaaagaattaacagagcaaatt
gagaaagataagcaggaagccatccgttatttcagcaatttgcggaaataa

DBGET integrated database retrieval system