KEGG   Bacillus subtilis BSn5: BSn5_07035Help
Entry
BSn5_07035        CDS       T01417                                 

Definition
(GenBank) putative p-nitrophenyl phosphatase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00627  Aminobenzoate degradation
bsn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    BSn5_07035
Enzymes [BR:bsn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     BSn5_07035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase Hydrolase_3 Acid_phosphat_B
Motif
Other DBs
NCBI-ProteinID: ADV94033
Structure
PDB: 

Position
complement(1325625..1326395)
Genome map
AA seq 256 aa AA seqDB search
MKTYKGYLIDLDGTMYNGTEKIEEACEFVRTLKDRGVPYLFVTNNSSRTPKQVADKLVSF
DIPATEEQVFTTSMATAQHIAQQKKDASVYVIGEEGIRQAIEENGLTFGGENADFVVVGI
DRSITYEKFAVGCLAIRNGARFISTNGDIAIPTERGLLPGNGSLTSVLTVSTGVQPVFIG
KPESIIMEQAMRVLGTDVSETLMVGDNYATDIMAGINAGMDTLLVHTGVTKREHMTDDME
KPTHAIDSLTEWIPYI
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatataaagggtatttaattgatttagacggaacgatgtacaatggcacggaa
aaaatcgaggaagcgtgtgaatttgtcagaacgctgaaagatcgcggcgttccttatctt
ttcgtgacaaacaactcttcgcgtacaccgaagcaggtagcggacaagctcgtgtctttt
gatattccggcaacagaagagcaggtcttcacgaccagcatggcaactgcccagcacatt
gcacagcagaaaaaagacgcgtctgtgtatgtgattggggaggaaggaatccgccaggcg
attgaagaaaacggcctgacatttggcggagaaaacgcggactttgtcgttgttggcatc
gaccgttccattacatacgaaaaatttgctgtcggctgcctggcaatcagaaatggcgcc
cgctttatttccactaacggagatattgcgattccgactgaaagaggccttctgccggga
aacggctcactgacatcggtgttaaccgtatctacaggtgtacagcctgtatttatcggc
aagccggaatcaattattatggagcaggcgatgcgcgttctcggcacagatgtgtctgaa
acactcatggtcggcgacaactacgccactgatattatggccggcattaacgcgggtatg
gatacgctgctcgttcacacaggcgtaacgaaaagagaacatatgacagacgatatggaa
aaaccgactcacgccattgactctctgactgaatggattccatacatttga

DBGET integrated database retrieval system