KEGG   Bacillus subtilis BSn5: BSn5_14995Help
Entry
BSn5_14995        CDS       T01417                                 

Definition
(GenBank) acetoin reductase/2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BSn5_14995
Enzymes [BR:bsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BSn5_14995
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BSn5_14995
    1.1.1.-  
     BSn5_14995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N 2-Hacid_dh_C F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ADV95607
Position
complement(2899031..2900071)
Genome map
AA seq 346 aa AA seqDB search
MKAARWHNQKDIRIEHIEEPKTEPGKVKIKVKWCGICGSDLHEYLGGPIFIPVDKPHPLT
NETAPVTMGHEFSGEVVEVGEGVENYKVGDRVVVEPIFATHGHQGAYNLDEQMGFLGLAG
GGGGFSEYVSVDEELLFKLPDELSYEQGALVEPSAVALYAVRSSKLKAGDKAAVFGCGPI
GLLVIEALKAAGATDIYAVELSPERQQKAEELGAIIVDPSKTDDVVAEIAERTGGGVDVA
FEVTGVPVVLRQAIQSTTIAGETVIVSIWEKGAEIHPNDIVIKERTVKGIIGYRDIFPAV
LSLMKEGYFSADKLVTKKIVLDDLIEEGFGALIKEKSQVKILVRPN
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcaagatggcataaccaaaaggatatccgtattgaacatatcgaagagcca
aaaacggagccgggaaaagtaaagatcaaagtcaaatggtgcggcatctgcggaagtgat
ttacacgaatatctgggcggcccgatctttattccggttgacaaaccgcacccattaaca
aatgaaacggcaccagtcacaatggggcatgaattctccggtgaagttgtcgaagtcgga
gaaggcgttgaaaattataaggttggagaccgcgttgtagtcgagccgatttttgctaca
cacggccaccaaggcgcctacaaccttgatgaacaaatgggattcctcggcttagccggc
ggaggcggcggtttctctgaatacgtctctgtagatgaagagcttttgttcaaacttcct
gatgaattatcatatgaacaaggcgcgctcgttgaaccttctgcagttgctctatacgct
gtccgctcaagcaaactcaaagcaggcgacaaagcggctgtattcggctgcggcccgatc
ggacttcttgtcattgaagcgctgaaggctgccggtgcaaccgatatttacgctgttgag
ctttctcctgaacgccagcaaaaagctgaggagcttggcgcgatcatcgttgatccgtct
aaaacagacgatgtagtcgctgagattgcagaacgtacaggaggcggtgttgacgtagca
tttgaagtcactggtgtcccagtggtgttacgacaagccatccagtccactacaatcgcc
ggtgaaaccgtcatcgtcagtatttgggaaaaaggtgctgaaatccatccgaacgatatc
gtaatcaaagaacgtacagtaaaaggaattatcggataccgcgacatcttcccggctgta
ttgtcattaatgaaagaaggctatttctcagccgacaaactcgtaacgaaaaaaatcgta
ctagatgatttgatcgaggaaggcttcggggctcttattaaagagaaaagccaagtcaaa
atccttgttagacctaactaa

DBGET integrated database retrieval system