KEGG   Bacillus subtilis BSn5: BSn5_15470Help
Entry
BSn5_15470        CDS       T01417                                 

Definition
(GenBank) putative glycosidase
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00052  Galactose metabolism
bsn00561  Glycerolipid metabolism
bsn00600  Sphingolipid metabolism
bsn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BSn5_15470
  Lipid metabolism
   00561 Glycerolipid metabolism
    BSn5_15470
   00600 Sphingolipid metabolism
    BSn5_15470
Enzymes [BR:bsn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BSn5_15470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: ADV95702
Structure
PDB: 

Position
3000854..3002194
Genome map
AA seq 446 aa AA seqDB search
MFHISTLDQIKIAYIGGGSQGWARSLMSDLSIDERMSGTVALYDLDFEAAQKNEVIGNHS
GNGRWRYEAVSTLKKALSAADIVIISILPGSLDDMEVDVHLPERCGIYQSVGDTVGPGGI
IRGLRAVPIFAEIARAIRDYAPESWVINYTNPMSVCTRVLYKVFPGIKAIGCCHEVFGTQ
KLLAEMVTERLGIEVPRREDIRVNVLGINHFTWITKASYRHIDLLPIFREFSAHYGESGY
ELEGESWRDSVFCSAHRVAFDLFETYGSIPAAGDRHLAEFLPGPYLKQPEVWKFHLTPIS
FRKQDRAEKRQETERLIVQQRGVAEKASGEEGVNIIAALLGLGELVTNVNMPNQGQVSNL
PIQAIVETNAFITRNRVQPILSGALPKGVEMLAARHIFNQEAVADAGLTKDTGLAFQAFL
NDPLVKIDRSDAEQLFNDMLQCTMQR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcatatcagtacattagatcagattaagattgcctatattggcggggggtcccaa
ggctgggccagaagcctgatgagtgatttgtcgattgatgaacgtatgtcaggcacggtg
gcgctctatgatcttgattttgaagccgctcagaaaaatgaagtgatcggcaatcacagc
gggaacggcagatggagatatgaggctgtttctactttgaaaaaggcgttatcagccgcg
gatatcgtcattatttccattttgccgggatcactggatgatatggaagtcgatgtccac
ttgcctgagcgctgcggtatttatcagtctgtaggtgatactgtcgggcctggagggatc
atcaggggcttgcgtgctgtgccgatatttgcggaaattgcccgggcaataagagactac
gcacctgaatcatgggtcattaattatacaaacccgatgtctgtctgtacaagagtgctg
tataaagtgtttcccggcatcaaagcgattggctgctgccacgaggtattcgggacgcaa
aagctattggcggaaatggtcacggaaaggctggggatagaggtgccgcggcgtgaggat
atccgcgttaatgtgctcggcattaaccattttacatggatcacaaaagcctcttaccgc
catattgacctgctgcctatattccgtgaattcagcgcgcactatggggaatcaggatat
gagctggagggggaaagctggagggacagcgtcttttgttcggcacaccgtgttgcgttt
gatttatttgaaacgtatggctccatccctgctgcgggagacaggcatctggcagagttt
cttcccggcccatacctcaaacagcctgaagtatggaaatttcatctcacacctatatca
ttcagaaaacaagacagagctgagaaacgacaagaaacagaacggttgatcgtgcaacaa
cggggcgttgctgagaaagcttcgggagaagaaggcgtgaacatcatagcggctcttctc
ggattgggtgaactcgtcacaaatgtaaatatgccgaatcaaggccaggtctcaaacctc
cctatacaagccattgtcgaaacaaacgcattcatcacaaggaaccgtgtccagccgatt
ttgtccggagcgcttccgaaaggtgtggaaatgctggcggctaggcatatattcaatcag
gaggcagtggcggacgcaggtttaacaaaggatactggcctcgcgtttcaagccttcctc
aatgacccgcttgtcaagattgaccgcagtgatgcagagcagcttttcaatgacatgctc
caatgcaccatgcaacgttga

DBGET integrated database retrieval system