KEGG   Bacillus subtilis BSn5: BSn5_17060Help
Entry
BSn5_17060        CDS       T01417                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00071  Fatty acid degradation
bsn00072  Synthesis and degradation of ketone bodies
bsn00280  Valine, leucine and isoleucine degradation
bsn00310  Lysine degradation
bsn00362  Benzoate degradation
bsn00380  Tryptophan metabolism
bsn00620  Pyruvate metabolism
bsn00630  Glyoxylate and dicarboxylate metabolism
bsn00640  Propanoate metabolism
bsn00650  Butanoate metabolism
bsn00900  Terpenoid backbone biosynthesis
bsn01100  Metabolic pathways
bsn01110  Biosynthesis of secondary metabolites
bsn01120  Microbial metabolism in diverse environments
bsn01130  Biosynthesis of antibiotics
bsn01200  Carbon metabolism
bsn01212  Fatty acid metabolism
bsn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSn5_17060
   00630 Glyoxylate and dicarboxylate metabolism
    BSn5_17060
   00640 Propanoate metabolism
    BSn5_17060
   00650 Butanoate metabolism
    BSn5_17060
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSn5_17060
   00072 Synthesis and degradation of ketone bodies
    BSn5_17060
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSn5_17060
   00310 Lysine degradation
    BSn5_17060
   00380 Tryptophan metabolism
    BSn5_17060
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSn5_17060
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSn5_17060
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSn5_17060
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsn04147]
    BSn5_17060
Enzymes [BR:bsn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSn5_17060
Exosome [BR:bsn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSn5_17060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADV96020
Position
complement(3320292..3321386)
Genome map
AA seq 364 aa AA seqDB search
MNAVIVDAKRTIFGNQNGLLKPFLPEDLAAPIIRCLSRKLEDQVDEVILGNATGRGGNLA
RLSALQAGLPLSVPGMTIDRQCGSGLEAVRYACSLIQAGAGTMYIAGGSESSSQSPFSER
ARFSPDAIGDPDMGIAAEYTAARYSISRGMQDEYALLSHQRSRNAHDEGFYREEIVPLGE
LETDEAFLKTRPIKAIIPRAKPVFDTSSGTVTAANSSGIADGAAALLVMEEEKAAALGLK
PVLRFIGSAVSGIHPNFPPAAPVVAIRQLLHTHDVTPDDIDLFEINEAFAVKICVCSQEL
GIPFSKINVRGGALALGHPYGASGAALVTRLFYEAKRRPDCQYAVAAIGSGGGIGLALLF
EVLA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcggttattgttgatgcaaaacgaacgatctttggaaatcaaaacggactgctg
aagcccttcctgccggaggatttggcggctcccatcatccgctgtctcagccgaaagcta
gaggatcaagttgacgaggtcattctcggaaacgctactggcagaggcggcaacctggcc
agactgtcagcccttcaagccggactgcctttatcggttcccggaatgacaattgacaga
cagtgcggctcaggccttgaagctgtgcgctatgcctgcagccttattcaagcgggagcc
ggcacgatgtatatcgcgggcggctcagaaagcagcagccaatcccctttttcagaacgg
gcccgcttttctccagatgcgattggcgatccagacatgggcattgcagcagaatatacg
gctgcacgctattccatcagcagaggcatgcaggatgagtacgcgcttctcagccatcaa
cgcagcaggaacgcgcatgatgaaggattttaccgtgaagaaattgttcctctcggggaa
ttggagacggacgaagcatttttgaaaacgcggccgataaaagcgattattccccgtgca
aagccggttttcgacaccagctccggaacagtcacagcagccaacagcagtggcatagca
gacggagcagccgctcttttggtaatggaagaagaaaaagcggcagccctgggacttaag
cctgtgctccggtttatcggcagcgctgtcagcgggattcaccccaactttccgcccgcg
gcaccggttgtcgcgattcgtcagctcttacatacacacgatgtaacacctgatgatatc
gatttatttgaaatcaatgaagcctttgccgtcaaaatttgtgtctgctcgcaagaactc
ggcattcccttttcaaaaatcaatgtgcgcggcggcgccttagctcttggccatccgtac
ggtgcatcaggtgcagctctggtaaccagattgttttatgaagcgaaaagacggccagac
tgtcaatatgctgttgcagccatcggaagcggcggcggaattggactggctttattattt
gaagttcttgcatag

DBGET integrated database retrieval system