KEGG   Bacillus subtilis BSn5: BSn5_17860Help
Entry
BSn5_17860        CDS       T01417                                 

Definition
(GenBank) cystathionine gamma-synthase
  KO
K01739  cystathionine gamma-synthase [EC:2.5.1.48]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00270  Cysteine and methionine metabolism
bsn00450  Selenocompound metabolism
bsn00920  Sulfur metabolism
bsn01100  Metabolic pathways
bsn01110  Biosynthesis of secondary metabolites
bsn01130  Biosynthesis of antibiotics
bsn01230  Biosynthesis of amino acids
Module
bsn_M00017  Methionine biosynthesis, apartate => homoserine => methionine
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    BSn5_17860
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSn5_17860
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BSn5_17860
Enzymes [BR:bsn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.48  cystathionine gamma-synthase
     BSn5_17860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 GDC-P Met_gamma_lyase
Motif
Other DBs
NCBI-ProteinID: ADV96180
Position
3469395..3470516
Genome map
AA seq 373 aa AA seqDB search
MSQHVETKLAQIGNRSDEVTGTVSAPIYLSTAYRHRGIGESTGFDYVRTKNPTRQLVEDA
IANLENGARGLAFSSGMAAIQTIMALFKSGDELIVSSDLYGGTYRLFENEWKKYGLTFHY
DDFSDEDCLRSKITPNTKAVFVETPTNPLMQEADIEHIARMTKEHGLLLIVDNTFYTPVL
QRPLELGADIVIHSATKYLGGHNDLLAGLVVVKDEQLGEEMFQHQNAIGAVLPPFDSWLL
MRGMKTLSLRMRQHQANAQELAAFLEEQEEISDVLYPGKGGMLSFRLQKEEWVNPFLKAL
KTICFAESLGGVESFITYPATQTHMDIPEEIRIANGVCNRLLRFSVGIEHAEDLKEDLKQ
ALCQVKEGAVSFE
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagcacgttgaaacgaaattagcccaaattgggaaccgtagcgatgaagtcacg
ggaacagtgagtgctcctatttatttatcaacagcataccgccacagagggatcggagaa
tctaccggatttgattatgtccgcacaaaaaatccgacacgccagcttgttgaggacgcc
atcgctaacttagaaaacggcgcgagagggcttgcttttagttcgggaatggctgctatc
caaacgattatggcgctgtttaaaagcggagatgaactgatcgtttcatcggacctatat
ggcggcacgtaccgtttatttgaaaatgaatggaaaaaatacggattgacttttcattat
gatgatttcagcgatgaggactgtttacgctctaagattacgccgaatacaaaagcggtg
tttgtggaaacgccgacaaaccccctcatgcaggaggcggacattgaacatattgcccgg
atgacaaaggagcacggtcttctgctgatcgtagataatacattttatacaccggtcttg
cagaggccgctagagctgggagctgacattgtcattcacagcgcaaccaagtatttaggc
gggcataacgatctgcttgctggacttgtcgtggtgaaggatgagcagctcggagaggaa
atgtttcagcatcaaaatgcgatcggcgccgtcctgccgccatttgattcgtggcttctg
atgagaggaatgaagacgctgagccttagaatgcgtcagcatcaggcaaacgcgcaggag
cttgcggcttttttagaagagcaggaagaaatttcggatgtgctgtatcccggaaaaggc
ggcatgctgtccttccgtctgcaaaaagaagaatgggtcaatccgtttttaaaagcactg
aagaccatttgttttgcagaaagcctcggcggggtggaaagctttattacataccctgcg
acccagacgcacatggatattcctgaagagatccgcatcgcaaacggggtgtgcaatcgg
ttgctgcgcttttctgtcggtattgaacatgcggaagatttaaaagaggatctaaaacag
gcattatgtcaggtcaaagagggagctgtttcatttgagtaa

DBGET integrated database retrieval system