KEGG   Bacillus subtilis BSn5: BSn5_18080Help
Entry
BSn5_18080        CDS       T01417                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00860  Porphyrin and chlorophyll metabolism
bsn01100  Metabolic pathways
bsn01110  Biosynthesis of secondary metabolites
bsn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BSn5_18080 (hemD)
Enzymes [BR:bsn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BSn5_18080 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Oxidored_nitro DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: ADV96224
Position
3506684..3507496
Genome map
AA seq 270 aa AA seqDB search
MGKGLLGKRVAIGGSRKTEEISTIIEKQGGIPVIRPLQGTVYLAEKQVEPDLRTFAEEKA
DWVIFTTGIGLETLVDMAEKIGLKDEFLQAIRQAKAACRGYKTLSALKKLGITPEASDED
GTTRGLIRSLEPHDFSGKTVMVQLHGEKAPALMAFLEEKGASVLPILPYQHIPPEEETVE
RLCRELMNDEIDAVCFTTAIQVRSLFDFAKGRGYINEVKKVFEERAIAAAVGKVTAEALR
EEGITRLLAPEIERMGAMIVELAKYYEEKE
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaagggttacttggaaaacgtgtggcaatcggtggctcacgaaaaacggaagaa
atcagtacaatcattgaaaaacagggcggaatacctgtcatccggcctctccaaggtaca
gtttacttagcagagaagcaggtggagccggatttgcggacgtttgcggaagaaaaagct
gactgggtcattttcacgacaggcatcgggttggagactcttgtcgatatggcagagaaa
attggactgaaagatgagtttctgcaggccattcgccaagcgaaagcggcatgccgggga
tacaaaacgctgtctgcgttgaaaaagcttgggatcacaccggaagcttcggatgaagac
gggacaacaagaggcttaatccgttctttggagcctcacgacttttcaggaaaaacagtc
atggtgcagcttcatggcgaaaaagcgccggctctcatggcatttcttgaagaaaaaggc
gcgtctgtcctgccgattctgccttatcagcacatcccgccggaggaggaaacggtggag
cggttatgccgagagctgatgaacgatgagatcgatgccgtttgttttacaacggccatt
caggttcgttccctgtttgattttgccaaggggcgaggttatatcaatgaagtgaagaag
gtattcgaagaacgcgccatcgcagctgctgtcggaaaagtgactgctgaagcactgcgg
gaagagggcattacgagactgcttgcgccagagattgagcggatgggtgcgatgattgtt
gagctggccaagtattatgaagaaaaggaataa

DBGET integrated database retrieval system