KEGG   Bacillus subtilis BSn5: BSn5_18820Help
Entry
BSn5_18820        CDS       T01417                                 

Gene name
mtnA
Definition
(GenBank) methylthioribose-1-phosphate isomerase
  KO
K08963  methylthioribose-1-phosphate isomerase [EC:5.3.1.23]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00270  Cysteine and methionine metabolism
bsn01100  Metabolic pathways
Module
bsn_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bsn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BSn5_18820 (mtnA)
Enzymes [BR:bsn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.23  S-methyl-5-thioribose-1-phosphate isomerase
     BSn5_18820 (mtnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF-2B
Motif
Other DBs
NCBI-ProteinID: ADV96370
Structure
PDB: 

Position
complement(3636073..3637134)
Genome map
AA seq 353 aa AA seqDB search
MTHSFAVPRSVEWKETAITILNQQKLPDETEYLELTTKEDVFDAIVTLKVRGAPAIGITA
AFGLALAAKDIETDNVTEFRRRLEDIKQYLNSSRPTAINLSWALERLSHSVENAISVNEA
KTNLVHEAIQIQVEDEETCRLIGQNALQLFKKGDRIMTICNAGSIATSRYGTALAPFYLA
KQKDLGLHIYACETRPVLQGSRLTAWELMQEGIDVTLITDSMAAHTMKEKQISAVIVGAD
RIAKNGDTANKIGTYGLAILANAFDIPFFVAAPLSTFDTKVKCGADIPIEERDPEEVRQI
SGVRTAPSNVPVFNPAFDITPRDLISGIITEKGIMTGNYEEEIEQLFKGEKVH
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgacccattcatttgctgttccacgttctgttgaatggaaagaaacagctattaccatt
ttaaatcagcaaaagcttcctgatgagacggaatatttggagctgacgacgaaagaggat
gtatttgatgcgattgtcacgctcaaagtaaggggcgctccggcgatcggcattacggct
gccttcggactggcgcttgctgccaaagacattgaaacagacaatgtcacggaattccgc
cgcagactggaagacatcaaacaatatttaaacagctcacggcctaccgccattaatttg
tcatgggcgcttgagagactgagtcattcggtcgaaaacgcgatttccgtaaatgaagca
aaaacaaaccttgtccatgaagccattcagattcaggtcgaggatgaggaaacgtgccgg
ttgatcggccaaaacgccctgcagcttttcaaaaaaggcgacaggatcatgacaatctgc
aatgccggctcaatcgcgacaagccgctatggaacggcgctagctccgttttacttggcc
aaacaaaaagatttgggattgcacatttatgcctgtgaaacaaggcctgtcctgcaaggt
tcacgccttactgcttgggagctgatgcaggagggcattgatgtcactctgatcacagac
agcatggccgcccatacgatgaaggaaaaacaaatttccgctgttatcgtcggagccgac
cgaattgcaaagaacggtgatacggcaaataaaatcggcacatacggtcttgctatttta
gcaaacgcctttgatattccgttttttgtcgccgcacctttatctacatttgatacaaag
gtcaaatgcggcgctgatatcccgatagaggaacgggatcccgaggaagtcaggcagatt
tccggagttcggaccgctccatccaatgtgcctgtctttaatcccgctttcgacattaca
cctcgtgatctcatttcaggaatcatcacagaaaaagggattatgaccggaaactatgaa
gaagagattgaacagctgtttaaaggagaaaaggtgcattaa

DBGET integrated database retrieval system