KEGG   Bacillus subtilis BSn5: BSn5_19290Help
Entry
BSn5_19290        CDS       T01417                                 

Definition
(GenBank) 2-dehydropantoate 2-reductase
  KO
K00077  2-dehydropantoate 2-reductase [EC:1.1.1.169]
Organism
bsn  Bacillus subtilis BSn5
Pathway
bsn00770  Pantothenate and CoA biosynthesis
bsn01100  Metabolic pathways
bsn01110  Biosynthesis of secondary metabolites
Module
bsn_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:bsn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BSn5_19290
Enzymes [BR:bsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.169  2-dehydropantoate 2-reductase
     BSn5_19290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ApbA ApbA_C F420_oxidored TrkA_N Epimerase
Motif
Other DBs
NCBI-ProteinID: ADV96462
Position
3724554..3725465
Genome map
AA seq 303 aa AA seqDB search
MKFLVVGAGGVGGYIGGRLSEKGNDVTFLVRQKRAEQLKKTGLVIHSEKGNVSFQPELIS
AGETGQFDVVIIASKAYSLGQVIEDVKPFIHQESVIIPFLNGYRHYEQLFAAFSKEQVLG
GLCFIESALDNKGEIHHTSTSHRFVFGEWNGERTERIRALEEAFSGVKAEVIISGHIEKD
IWKKYLFIAAQAGITTLFQRPLGPILATEAGRHTAQTLIGEICAVLRKEGVPADPDLEEE
SFRTMTSMSYHMKSSMLRDMENGQTTEGDHLHGFLLEKAKRLSLAAPVLETVYANLQMYE
AEK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttttggttgtcggagcaggtggagtaggcgggtatattggcggacggctttcg
gagaaaggaaatgatgtgacatttctcgtgcgccaaaaacgagctgagcagcttaaaaaa
accgggcttgtcatccatagtgaaaaagggaatgtatcatttcagcccgaactaatcagt
gccggagaaacagggcaatttgatgtcgttatcattgcttctaaagcatactcacttggt
caagtgatagaggatgtcaaaccatttatccatcaggaatctgtcattatccctttctta
aacgggtaccgccactatgagcagctatttgcggcattttcaaaagaacaggtgctgggc
ggcctgtgttttatagaaagtgctttagacaacaaaggagaaattcatcatacgagcaca
tcgcatcgttttgtatttggagaatggaacggcgagcgtacggagcggataagagcgctt
gaagaggcattttcaggtgtgaaggctgaagtcatcattagcgggcatatcgagaaggac
atttggaaaaagtatctctttattgcagcgcaagcggggatcacaacgttatttcaacga
ccgcttggcccaatcctcgccacagaagccggacgtcacacggcccaaactcttattggg
gaaatttgcgctgttttacgaaaagaaggtgttccggctgatccggatcttgaggaagag
agctttcgtacgatgaccagcatgtcttaccatatgaagtcctccatgcttcgagatatg
gaaaacggccaaacgactgaaggagaccacctgcatggatttttgcttgaaaaagcaaaa
cgtttatctctcgcagcaccagtattagaaaccgtttatgcgaatctgcaaatgtatgaa
gcagaaaaataa

DBGET integrated database retrieval system