KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_07250Help
Entry
BSNT_07250        CDS       T02607                                 

Gene name
fabL
Definition
(GenBank) enoyl-(acyl carrier protein) reductase
  KO
K10780  enoyl-[acyl-carrier protein] reductase III [EC:1.3.1.104]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
bso00061  Fatty acid biosynthesis
bso01100  Metabolic pathways
bso01212  Fatty acid metabolism
Module
bso_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bso00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BSNT_07250 (fabL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bso01004]
    BSNT_07250 (fabL)
Enzymes [BR:bso01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.104  enoyl-[acyl-carrier-protein] reductase (NADPH)
     BSNT_07250 (fabL)
Lipid biosynthesis proteins [BR:bso01004]
 Fatty acid synthase
  Component type
   BSNT_07250 (fabL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Aminotran_5 Epimerase
Motif
Other DBs
NCBI-ProteinID: BAI84384
UniProt: D4G6M8
Structure
PDB: 

Position
917182..917934
Genome map
AA seq 250 aa AA seqDB search
MEQNKCALVTGSSRGVGKAAAIRLAENGYNIVINYARSKKAALETAEEIEKLGVKVLVVK
ANVGQPAKIKEMFQQIDETFGRLDVFVNNAASGVLRPVMELEETHWDWTMNINAKALLFC
AQEAAKLMEKNGGGHIVSISSLGSIRYLENYTTVGVSKAALEALTRYLAVELSPKQIIVN
AVSGGAIDTDALKHFPNREDLLEDARQNTPAGRMVEIKDMVDTVEFLVSSKADMIRGQTI
IVDGGRSLLV
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaaataaatgtgcactcgtaacaggaagcagccgcggtgtcggaaaagcggcc
gcgatcagacttgctgagaacggctataacatcgtcattaactatgcacgcagcaaaaaa
gcagcattagaaacagcggaagaaattgaaaagcttggcgttaaagtgcttgtcgtaaaa
gcaaacgtaggacagcctgcaaaaatcaaagaaatgtttcagcaaattgatgaaacgttc
ggcagacttgatgtttttgtcaataatgccgcttcaggagtactaagacctgtcatggaa
ttagaagaaacacactgggactggacgatgaacattaatgcgaaagcattgcttttctgc
gctcaggaagctgccaagctaatggagaagaacggaggcgggcatattgtcagcatcagt
tcattaggctctatccgctatcttgaaaactacaccacggtcggtgtatcaaaagcagcg
ttagaggctttaacccgttatcttgccgttgagctttcaccaaaacaaattatcgtcaat
gctgtttcaggcggagcgatcgacacagatgcgctgaaacacttcccgaatagagaagat
ctgcttgaggatgcgcgccaaaacacgccggcgggacgcatggtcgaaattaaagacatg
gttgatactgttgagtttctagtgtcttccaaggctgacatgatccgcggacagacaatt
atcgttgacggcggacgctcactgctcgtttaa

DBGET integrated database retrieval system