KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_07473Help
Entry
BSNT_07473        CDS       T02607                                 

Gene name
yhfS
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
bso00071  Fatty acid degradation
bso00072  Synthesis and degradation of ketone bodies
bso00280  Valine, leucine and isoleucine degradation
bso00310  Lysine degradation
bso00362  Benzoate degradation
bso00380  Tryptophan metabolism
bso00620  Pyruvate metabolism
bso00630  Glyoxylate and dicarboxylate metabolism
bso00640  Propanoate metabolism
bso00650  Butanoate metabolism
bso00900  Terpenoid backbone biosynthesis
bso01100  Metabolic pathways
bso01110  Biosynthesis of secondary metabolites
bso01120  Microbial metabolism in diverse environments
bso01130  Biosynthesis of antibiotics
bso01200  Carbon metabolism
bso01212  Fatty acid metabolism
bso02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSNT_07473 (yhfS)
   00630 Glyoxylate and dicarboxylate metabolism
    BSNT_07473 (yhfS)
   00640 Propanoate metabolism
    BSNT_07473 (yhfS)
   00650 Butanoate metabolism
    BSNT_07473 (yhfS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSNT_07473 (yhfS)
   00072 Synthesis and degradation of ketone bodies
    BSNT_07473 (yhfS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSNT_07473 (yhfS)
   00310 Lysine degradation
    BSNT_07473 (yhfS)
   00380 Tryptophan metabolism
    BSNT_07473 (yhfS)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSNT_07473 (yhfS)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSNT_07473 (yhfS)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSNT_07473 (yhfS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bso04147]
    BSNT_07473 (yhfS)
Enzymes [BR:bso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSNT_07473 (yhfS)
Exosome [BR:bso04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSNT_07473 (yhfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAI84587
UniProt: D4G781
Position
complement(1109685..1110779)
Genome map
AA seq 364 aa AA seqDB search
MNAVIIDAKRTIFGNQNGLLKPFLPEDLAAPIIRCLSRKLEDQVDEVILGNATGRGGNLA
RLSALQAGLPLSVPGMTIDRQCGSGLEAVRYACSLIQAGAGTMYIAGGSESSSQSPFSER
ARFSPDAIGDPDMGIAAEYTAARYSISRSMQDEYALLSHQRSRNAHEEGFYREEVVALGE
LETDEAFLKTRPIEAIIPRAKPVFDTSSGTVTAANSSGIADGAAALLVMEEEKAAALGLK
PVLRFIGSAVSGIHPNYPPAAPVDAIRNLLHTHDVTPEDIGLFEINEAFAVKICVCSQEL
GIPFSKINVRGGALALGHPYGASGAALVTRLFYEAKRRTDCQYVVAAIGSGGGIGLALLF
EVLA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcggttattattgatgcaaaacgaacgatctttggaaatcaaaacggactgctg
aagcccttcctgccggaggatttggcggctcccatcatccgctgtctcagccgaaagcta
gaggatcaagttgacgaggtcattctcggaaacgctactggcagaggcggcaacctggcc
agactgtcagcccttcaagccggactgcctttatcagttcccggaatgacaattgacaga
cagtgcggctccggccttgaagctgtgcgctatgcctgcagccttattcaagcaggagcc
ggcacgatgtatatcgcgggcggctcagaaagcagcagccaatcccctttttcagaacgg
gctcgcttttctccagatgcgatcggcgatccagacatgggcattgcggcagaatatacg
gctgcacgctattccatcagcagaagcatgcaggatgagtacgcgcttctcagccatcaa
cgcagcaggaacgcgcatgaggaaggattttaccgtgaagaagttgttgctctcggggaa
ttggagacggacgaagcatttttgaaaacgcggccaatagaagcgattattccccgtgca
aagccggttttcgacaccagctccggaacagtcacagcagccaacagcagtggcatagca
gacggagcagcggctcttttggtaatggaagaagaaaaagcggcagccctgggacttaag
cctgtgcttcggtttatcggcagcgctgtcagcgggattcaccccaactatccgcccgcg
gcaccggttgatgcgatccgtaatctcttacatacacacgatgtaacacctgaggatatc
ggtttatttgaaatcaatgaagcctttgccgtcaaaatttgtgtctgctcgcaagaactc
ggcattcccttttcaaaaatcaatgtgcgcggcggcgcattagctcttggccatccgtac
ggtgcatcaggtgcagctctggtaaccagattgttttatgaagcgaaaagacggacagac
tgtcaatatgttgttgcagccatcggaagcggcggcggaattggactggctttattattt
gaagttcttgcatag

DBGET integrated database retrieval system