KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_09069Help
Entry
BSNT_09069        CDS       T02607                                 

Gene name
yrpC
Definition
(GenBank) putative glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
bso00471  D-Glutamine and D-glutamate metabolism
bso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bso00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BSNT_09069 (yrpC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bso01011]
    BSNT_09069 (yrpC)
Enzymes [BR:bso01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BSNT_09069 (yrpC)
Peptidoglycan biosynthesis and degradation proteins [BR:bso01011]
 Precursor biosynthesis
  Racemase
   BSNT_09069 (yrpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Peripla_BP_1 PI-TkoII_IV
Motif
Other DBs
NCBI-ProteinID: BAI86155
UniProt: D4FZ74
Position
2499394..2500191
Genome map
AA seq 265 aa AA seqDB search
MKIGFFDSGIGGMTVLYEAIKVLPYEDYIFYADTLNVPYGEKSKGRVKEYIFNAAEFLAS
QNIKALVIACNTATSIAIEDLRRNFDFPIIGIEPAVKPAINKCTEERKRVLVVATNLTLK
EEKFHNLVKEIDHHDLVDCLALPGLVEFAENFDFSEDKIIKYLKNELSSFDLKQYGTIVL
GCTHFPFFKNSFEKLFGIKVDMISGSVGTAKQLKKVLADRNQLGKGSGSITFFDSGHKIV
DQEIISKYKRLFEILDETQRSHVRH
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataggattttttgattcaggaattggtggcatgactgtattgtatgaggccata
aaagttcttccttatgaagattacattttttatgcagatacgttaaacgttccatacggt
gaaaaatcaaagggtagagttaaagaatatattttcaatgcagctgaatttctagccagt
caaaatatcaaagctcttgttattgcgtgtaatacagctactagcattgcgatagaagat
cttcggagaaacttcgactttccgataatcggaatcgaacccgctgtaaagcctgctata
aataaatgtacagaggaaagaaaaagagttctggtagttgctactaatttgacgcttaaa
gaagagaaatttcataatctagttaaagaaattgatcaccatgaccttgttgattgctta
gctcttccaggactagttgaatttgctgagaactttgattttagtgaagacaaaatcatt
aaatatctaaagaacgaactatcttcttttgatctgaaacaatatggaacgattgtgtta
ggatgcactcattttccgtttttcaaaaacagttttgaaaaactgtttgggataaaagtt
gatatgatttcaggcagtgtcggtactgcaaaacagttgaaaaaagttcttgcagatcgt
aaccagcttggtaaaggatcgggctcaatcacctttttcgattctggccacaaaattgtg
gaccaagaaatcatatcaaagtacaaaagattgtttgaaatattagatgaaactcaaagg
agtcatgttagacattga

DBGET integrated database retrieval system