KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_10705Help
Entry
BSNT_10705        CDS       T02607                                 

Gene name
fbp
Definition
(GenBank) fructose-1,6-bisphosphatase
  KO
K04041  fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
bso00010  Glycolysis / Gluconeogenesis
bso00030  Pentose phosphate pathway
bso00051  Fructose and mannose metabolism
bso00680  Methane metabolism
bso01100  Metabolic pathways
bso01110  Biosynthesis of secondary metabolites
bso01120  Microbial metabolism in diverse environments
bso01130  Biosynthesis of antibiotics
bso01200  Carbon metabolism
Module
bso_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSNT_10705 (fbp)
   00030 Pentose phosphate pathway
    BSNT_10705 (fbp)
   00051 Fructose and mannose metabolism
    BSNT_10705 (fbp)
  09102 Energy metabolism
   00680 Methane metabolism
    BSNT_10705 (fbp)
Enzymes [BR:bso01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     BSNT_10705 (fbp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_2
Motif
Other DBs
NCBI-ProteinID: BAI87716
UniProt: D4G413
Position
4004564..4006435
Genome map
AA seq 623 aa AA seqDB search
MVTEIINLKAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGRVKEKIRDIFSGVIYDREI
DELAALVYYPEDKLKLIKHDFDAKAALNEWYKETINRMIKLVSYCSSKYTRSKLRKALPT
QFAYITEELLYKTEQAGNKEQYYSEIIDQIIELGQADKLITGLAYSVQRLVVDHLHVVGD
IYDRGPQPDRIMEELINYHSVDIQWGNHDVLWIGAYAGSKVCLANIIRICARYDNLDIIE
DVYGINLRPLLNLAEKYYDDNPAFRPKADDNRPEDEIKQITKIHQAIAMIQFKLESPIIK
RRPNFNMEERLLLEKIDYDKNEITLNGKTYQLENTCFATINPEQPDQLLEEEAEVIDKLL
FSVQHSEKLGRHMNFMMKKGSLYLKYNGNLLIHGCIPVDENGNMETMMIEDKPYAGRELL
DVFERFLREAFAHPEETDDLATDMAWYLWTGEYSSLFGKRAMTTFERYFIKEKETHKEKK
NPYYYLREDEATCRNILAEFGLNPDHGHIINGHTPVKEIEGEDPIKANGKMIVIDGGFSK
AYQSTTGIAGYTLLYNSYGMQLVAHKHFNSKAEVLSTGTDVLTVKRLVDKELERKKVKET
NVGEELLQEVAILESLREYRYMK
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
gtggtaacagaaatcattaatttgaaagcgatattgaacctgccaaaaggcaccgagcat
tttgtcagtgatttgcacggggagtatcaggcattccagcacgtgctgcgcaatggttca
ggacgagtcaaagagaagatacgcgacatcttcagcggtgtcatttacgatagagaaatc
gatgaattagcagcactggtctattatccggaagacaaactgaagttaatcaaacatgac
tttgatgcgaaagcagcattaaacgagtggtataaagaaacgattaaccgaatgattaag
ctcgtttcatattgctcctccaagtatacccgctccaaactgcgcaaagcactgcctact
cagtttgcttatattacggaggagctgctatacaaaacagaacaagcaggcaacaaggag
caatattactccgaaatcattgatcagatcattgagcttggccaagccgataagctgatc
accggccttgcttacagcgttcagcggctggtggtcgaccatctgcatgtggtcggcgat
atttacgaccgcggcccgcagccggataggattatggaagaactgatcaactatcattct
gtcgatattcagtggggaaatcacgatgtcctttggatcggagcctatgccgggtccaaa
gtgtgcttggccaatattatccgcatctgtgcccgctacgataacttggatattattgaa
gacgtgtacggcatcaacctgagaccgctgctgaacctggccgaaaaatattacgatgat
aatccagcattccgtccaaaagcagacgacaacaggccagaggatgagattaagcaaatc
acaaaaatccatcaggcgattgcgatgatccaattcaagcttgagagcccgattatcaag
agacggccgaactttaatatggaagagcggctgttattagagaaaatagattatgacaaa
aatgaaatcacgctgaacggtaaaacatatcaactggaaaacacctgctttgcgacgatt
aatccggagcagccagatcagctattagaagaagaagcagaagtcatagacaagctgcta
ttctctgtccagcattccgaaaagctgggccgccatatgaattttatgatgaaaaaaggc
agcctttatttaaaatataacggcaacctgttgattcacggctgtattcctgtcgatgaa
aacggcaatatggaaacgatgatgattgaggataaaccgtatgcgggccgtgagctgctc
gatgtatttgaacgattcttgcgggaagcctttgcccacccggaagaaaccgatgatctg
gcgactgatatggcctggtatttatggacaggcgagtactcctctctctttggaaaacgc
gccatgacaacatttgagcggtatttcattaaagagaaggaaacgcataaagaaaagaaa
aacccgtattattatttacgagaagacgaggcaacctgccgaaacatcctggcagaattc
ggcctcaatccagatcacggccatatcatcaacggccatacacccgtaaaagaaatcgaa
ggagaagacccaatcaaagcaaacggaaaaatgatcgtcatcgacggcggcttctccaaa
gcctaccaatccacaacaggcatcgctggctacacgctgctatacaactcctacggcatg
cagctcgtcgcccataaacacttcaactccaaggcagaagtcctaagcaccggaaccgac
gtcttaacggtgaagcgattagtggacaaagagcttgagcggaagaaagtgaaggaaacg
aatgtgggtgaggagctgctgcaggaagtggctattttggagagtttgcgggagtatcgg
tatatgaagtga

DBGET integrated database retrieval system