KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_10739Help
Entry
BSNT_10739        CDS       T02607                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
bso00220  Arginine biosynthesis
bso00330  Arginine and proline metabolism
bso01100  Metabolic pathways
bso01110  Biosynthesis of secondary metabolites
bso01130  Biosynthesis of antibiotics
bso01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bso00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    BSNT_10739 (rocF)
   00330 Arginine and proline metabolism
    BSNT_10739 (rocF)
Enzymes [BR:bso01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BSNT_10739 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase SHOCT
Motif
Other DBs
NCBI-ProteinID: BAI87738
UniProt: D4G435
Structure
PDB: 

Position
complement(4034861..4035751)
Genome map
AA seq 296 aa AA seqDB search
MDKTISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYTVEDLGDIPINREKIKND
EELKNLNSVLAGNEKLAQKVNKVIEEKKFPLVLGGDHSIAIGTLAGTAKHYDNLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGIGHESLVNLEGYAPKIKPENVVIIGARSLDEGER
KYIKESGMKVYTMHEIDRLGMTKVIEETLDYLSACDGVHLSLDLDGLDPNDAPGVGTPVV
GGISYRESHLAMEMLYDAGIITSAEFVEVNPILDHKNKTGKTAVELVESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggataaaacgatttcggttattggaatgccaatggatttaggacaagcacgacgcgga
gtagatatgggcccgagtgccatccggtacgctcatctgatcgagcggctgtcagacatg
gggtatacggttgaagatctcggtgacattccgatcaaccgcgaaaaaatcaaaaatgac
gaggaactgaaaaacctgaattccgttttggcgggaaatgaaaaactcgcgcaaaaggtc
aacaaagtcattgaagagaaaaaattcccgcttgtcctgggcggtgaccacagtattgcg
atcggcacgcttgcaggcacagcgaagcattacgataatctcggcgtcatctggtatgac
gcgcacggcgatttgaatacacttgaaacttcaccatcgggcaatattcacggcatgccg
ctcgcggtcagcctcggcattggccacgagtcactggttaaccttgaaggctacgcgcct
aaaatcaaaccggaaaacgtcgtcatcattggcgcccggtcacttgatgaaggggagcgc
aagtacattaaggaaagcggcatgaaggtgtacacaatgcacgaaatcgaccgtcttggc
atgacaaaggtcattgaagaaacccttgattatttatcagcatgtgatggcgtccatctg
agccttgatctggacggacttgatccgaacgacgcaccgggtgtcggaacccctgtcgtc
ggcggcatcagctatcgggagagccatttggctatggaaatgctgtatgacgcaggcatc
attacctcagccgaattcgttgaggttaacccgatccttgatcacaaaaacaaaacgggc
aaaacagcagtagagctggtagaatctctgctagggaagaagctgctgtaa

DBGET integrated database retrieval system