KEGG   Bacillus subtilis subsp. natto BEST195: BSNT_10759Help
Entry
BSNT_10759        CDS       T02607                                 

Gene name
purA
Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
bso  Bacillus subtilis subsp. natto BEST195
Pathway
bso00230  Purine metabolism
bso00250  Alanine, aspartate and glutamate metabolism
bso01100  Metabolic pathways
Module
bso_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bso00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BSNT_10759 (purA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSNT_10759 (purA)
Enzymes [BR:bso01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     BSNT_10759 (purA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt DUF664
Motif
Other DBs
NCBI-ProteinID: BAI87754
UniProt: D4G451
Position
complement(4052040..4053332)
Genome map
AA seq 430 aa AA seqDB search
MSSVVVVGTQWGDEGKGKITDFLSENAEVIARYQGGNNAGHTIKFDGITYKLHLIPSGIF
YKDKTCVIGNGMVVDPKALVTELAYLHERNVSTDNLRISNRAHVILPYHLKLDEVEEERK
GANKIGTTKKGIGPAYMDKAARIGIRIADLLDRDAFAEKLERNLEEKNRLLEKMYETEGF
KLEDILDKYYEYGQQIKKYVCDTSVVLNDALDEGRRVLFEGAQGVMLDIDQGTYPFVTSS
NPVAGGVTIGSGVGPTKIKHVVGVSKAYTTRVGDGPFPTELKDEIGDQIREVGREYGTTT
GRPRRVGWFDSVVVRHARRVSGITDLSLNSIDVLTGIETLKICVAYRYKGEIIEEFPASL
KALAECEPVYEEMPGWTEDITDAKSLSELPENARHYLERVSQLTGIPLSIFSVGPDRSQT
NVLRSVYRAN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagtagttgtagtaggtacgcaatggggcgatgaaggaaaaggtaaaattaca
gatttcctatcagaaaatgcagaagtgatcgcccgttatcaaggcggtaataacgcaggg
catacaatcaagtttgacggaatcacatataagcttcacttaatcccgtctggaattttc
tataaggataaaacgtgtgtaatcggaaacggaatggttgtagatccgaaagcattagtc
acagagcttgcgtatcttcatgagcgcaacgtgagtacagataacctgagaatcagcaac
agagctcacgtcattctgccgtatcatttgaaattggatgaagtggaagaagagcgtaaa
ggggctaacaagatcggcacaacgaaaaaaggaatcggccctgcttacatggataaagca
gcccgcatcggaattcgcatcgcggatctgttagaccgtgacgcgtttgcggaaaagctt
gagcgcaatcttgaagaaaaaaaccgtcttctcgagaaaatgtacgagacagaagggttt
aaacttgaggatatcttagacaaatattatgagtacggccagcagattaaaaaatatgtt
tgcgatacatctgttgtcttaaacgatgctcttgatgaagggcgccgtgtattatttgaa
ggcgcacaaggggttatgctcgatatcgaccaaggaacatacccgtttgttacgtcatct
aacccggttgccggcggtgtcacgatcggttctggtgtcggcccgaccaaaatcaagcac
gttgtcggtgtatcaaaagcatatacgactcgtgtcggcgacggtcctttcccgactgag
ctgaaagatgaaatcggcgatcaaatccgtgaagtcggacgcgaatatggaacaacaaca
ggccgcccgcgccgtgtcggctggtttgacagcgttgttgtccgccacgcccgccgtgtg
agcggaattacagatctttctctgaactcaattgacgtcctaacaggaattgaaacgttg
aaaatctgtgtggcgtaccgctacaaaggcgaaatcattgaagaatttccagcaagtctt
aaggcacttgctgaatgtgagccggtatatgaagaaatgccaggctggactgaggatatt
acagatgcgaagagcttgagcgagcttccggagaatgcgcgccattatcttgagcgtgtg
tctcagctgacaggcattccgctttctattttctctgtcggtccagaccgctcacaaaca
aatgtccttcgcagtgtgtaccgtgcgaactaa

DBGET integrated database retrieval system