KEGG   Baekduia soli: FSW04_06615Help
Entry
FSW04_06615       CDS       T06127                                 

Definition
(GenBank) AAA family ATPase
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
bsol  Baekduia soli
Pathway
bsol03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bsol00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    FSW04_06615
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bsol03400]
    FSW04_06615
Enzymes [BR:bsol01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FSW04_06615
DNA repair and recombination proteins [BR:bsol03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     FSW04_06615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C UvrD_C_2 PDDEXK_1 AAA_30 DUF1296 ResIII AAA
Motif
Other DBs
NCBI-ProteinID: QEC47293
UniProt: A0A5B8U2T6
Position
1416741..1420145
Genome map
AA seq 1134 aa AA seqDB search
MSEPRRFDVRGPLPTGVTVLEASAGTGKTYTIAALAARYVASGIPLHEILLVTFTRLATG
ELRERVRERLLQTEERLTHVLDGQAAPDDAVVQLLAAGPVDEVRARRDRLAHALADFDAA
TIATTHGFCLEALSGLGIVGDVEQGCDVTEDAFDLLEDVVDDLYVRRFGPKGSPAFSRHE
AHEIARAAVGNLKATILPLDTTGDGRPAMRARLAGVAREELERRKRLFGVLTFDDLLTRL
NTTLADPATGGFAVAKLRDRYKIALVDEFQDTDPIQWDIVRRAFAENLEDAGATQRALVL
IGDPKQAIYAFRGADVHAYLEAARVAGDQQTLATNWRSDQDLISALDAMFGGARLGHDEI
LYRTVQAVPAHRDRRLHGTPSDAALRIRIVQRDNPAVAVTKQGMASAQSAREHVADDVAA
DIVAVLTSNAEIEERSPSGATTGTHRVGPGDLAVLVRKHSQATLVHDALRRVRVPVVING
AGSVFAGDGAKAWQDLLQALERPTSGPRAHAAALTPFLGWTAQRVAEADDETWESVHRRL
HGWARVLRTRGVASLLEVITTSERLTERVLEIEDGERRMTDLRHVGQLLHQAAVDERLGT
TALAGWLRARIRAAIAEGGDEERTRRLESDADAVQVLTIHRSKGLEFPIVYCPFLWDTIW
RDDKVANPVVFHDDVDDARKVDVALEGSAYAAHAALATTEEEGEELRLAYVALTRARHQA
VIWWAGTRDTRSSPLSRLGFAREEDGTVRPQSDVPSDAEAAERFRRLGEAAAGCIAVERC
APRPLTQWQRPAPPDRDLCTARFDREIDRRWRRTSYSGITGAAHDPVVTSEPEARLRDDE
TPDGPPATTQATDQEVALHDVPLLLADMPGGTRVGTFVHHILEAVDFAAADLDAELQSAM
THELARRPLDVGDPAVARAGFGAVLETPLGSAVGDVRLADIAVPDRLDELEFELPLVGGD
APSGRLTLDALADLLRAHVPTGTPLHGYADRLGDERLQHDLRGYLTGSIDAVLRLPDGRF
AIVDYKTNRLGGPDVPLTAWHYRPAALDAAMQDSHYGLQALLYTVAVHRYLRWRLENYDP
DRHLAGVLYLFVRGMVGTDTPVVNGERCGVFTWQPSGVLVRALSDVLDRGAVTA
NT seq 3405 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgagccccggcgcttcgacgtccgcgggccgctgcccacaggggtcaccgtcctg
gaggccagcgcggggacgggcaagacgtacaccatcgccgcgctcgcggcgcggtacgtt
gcgtccggcatcccgctgcacgagatcctcctcgtgaccttcacgcggctggccacgggc
gagctgcgcgaacgggtccgcgagcggctcctgcagaccgaggaacggctcacgcacgtg
ctcgacggccaggctgcccccgacgatgcggtcgtgcagctcctggccgccggccccgtc
gacgaggtgcgcgcccggcgggaccggctggcccatgcgctcgccgacttcgacgccgcc
accatcgccacgacgcacgggttctgcctcgaggcgctcagcggtctggggatcgtcggc
gacgtcgagcagggctgcgatgtcaccgaggacgcgttcgatctgctcgaggacgtcgtg
gacgacctctacgtccgccggttcggccccaagggctcgccggccttcagccggcacgag
gcccatgagatcgcacgagccgcggtcggcaacctcaaggccacgatcttgccgctggac
accaccggcgatgggcggccggcgatgcgggcgcggctggccggcgtcgcgcgcgaggaa
ctcgaacggcgcaagcgactgttcggtgtcctgacctttgacgacctcctgacccggctg
aataccacgctcgcggatcccgcgaccggggggttcgcggtcgccaagctgcgcgaccgc
tacaagatcgccctggtcgacgagttccaggacaccgacccgatccagtgggacatcgtc
cgccgcgcgttcgccgagaacctcgaggacgcgggggcgacgcagcgcgcactcgtgctg
atcggcgatcccaagcaggcgatctacgccttccgtggggccgacgtccacgcctacctc
gaggcggcgcgcgtggcgggcgaccagcagacgctggccaccaactggcgcagcgaccag
gacctcatctccgccctggacgccatgttcggcggcgcccgtctcggccacgacgagatc
ctctaccgcacggtccaggccgtccccgcacaccgcgaccgccggttgcacggcacgcct
tcggacgccgcgctgcgcatccggatcgtgcagcgcgacaacccagcggtggcggtcacc
aagcaagggatggcgtcggcccagagcgcacgcgagcacgtggcggacgacgtcgccgcc
gacatcgtggcggttctgacctcgaacgcggagatcgaagagcgctcgccgtcgggcgcg
acgaccgggacgcaccgtgtcggcccgggtgatctcgcggtgctcgtccgcaagcacagc
caggcgacgctcgtgcacgacgcgctgcgccgcgtccgtgtgcccgtggtcatcaacggc
gccgggagcgtctttgccggcgacggcgcgaaggcctggcaggatctcctccaggcgctc
gagcgccccacctcggggccgcgcgcccacgccgccgcgctgacgccgttcctgggctgg
accgcccagcgcgtggccgaggccgacgacgagacctgggagtccgtccaccgtcgcttg
cacggctgggcgcgcgtcctgcggacccgcggcgtcgcttcgttgttggaggtcatcacc
acgtcggagcggttgaccgagcgggtcctggagatcgaggacggcgagcgccggatgacc
gacctgcgccacgtcggccagctcctgcatcaggccgcggtggacgagcgcctcggtacc
acggcgctggccgggtggctgcgcgcccggatccgcgccgccatcgccgaaggcggcgac
gaggagcgcacccgacggctggagtccgacgccgacgcggtgcaggttctgacgatccac
cgcagcaagggcctcgagttccccatcgtctactgcccgttcctgtgggacacgatctgg
cgcgacgacaaggtggccaacccggtcgtgttccacgacgacgttgacgacgcgcgcaag
gtcgacgtcgcgctcgagggctcggcctatgcggcgcacgccgcgctcgccacgacagag
gaagagggggaggaactgcgcctcgcctacgtcgcgcttacacgcgcgcgtcaccaggcg
gtgatctggtgggcaggcacacgcgacacgcgctcgtcgccactgagccggctcgggttc
gcgcgcgaggaggacgggaccgtgcgcccacagtccgacgtgccctccgacgcggaggcg
gccgagcggtttcgccggctgggggaggccgcggccgggtgcatcgccgtcgagcgctgt
gcgccgcgcccgctcacgcagtggcagcggcccgcgccgcccgaccgcgacctctgcacc
gcgcgcttcgaccgcgagatcgaccgccgctggcgccgcacgtcctacagcgggatcacc
ggcgccgcccacgacccggtcgtgacgagcgagcccgaggcgcggctgcgcgacgacgag
acgcccgatgggccaccggccacgacgcaagcaacggaccaggaagtggcgctgcacgac
gtgccgttgctcctcgccgacatgccgggcgggacgcgagtggggacgttcgtgcaccac
atccttgaggcggtggacttcgcggcggccgacctcgacgccgagctccagtcggccatg
acgcacgagctcgcccgccgcccgctcgacgtcggcgatcccgccgtggcccgggccgga
ttcggtgcggtcttggagacgccgctggggagtgccgtcggtgacgtccggctggccgac
atcgccgtgcccgatcgcctggacgagctggagttcgagctgccgctcgtcggcggcgac
gcgccgagcgggcggctgaccctcgacgccctcgccgatctgctgcgtgcacacgtcccc
accggcacgcccttgcacggctatgccgaccggctcggcgacgagcggctgcagcacgac
ctccgcggctatctgaccggcagcatcgatgccgtgctgcgcctgcccgacgggcgcttc
gccatcgtcgactacaagaccaaccgcctcggcgggccggacgttccgctgaccgcctgg
cactatcggccggcagccctcgacgcggcgatgcaggactcgcactacggcctacaggcg
ctgctctacaccgtggccgtgcaccggtatctgcgctggcggctggagaactacgatccg
gaccggcacctcgccggcgtcctctacctcttcgtgcgcggcatggtcgggaccgacacg
cccgtggtcaacggggagcggtgcggcgtgttcacctggcagcccagcggcgtcctggtc
cgcgcactgagcgacgtcctggaccgcggagcggtcacggcatga

DBGET integrated database retrieval system