KEGG   Baekduia soli: FSW04_10880Help
Entry
FSW04_10880       CDS       T06127                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bsol  Baekduia soli
Pathway
bsol00030  Pentose phosphate pathway
bsol00480  Glutathione metabolism
bsol01100  Metabolic pathways
bsol01110  Biosynthesis of secondary metabolites
bsol01120  Microbial metabolism in diverse environments
bsol01200  Carbon metabolism
Module
bsol_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bsol_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bsol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    FSW04_10880
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FSW04_10880
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsol04147]
    FSW04_10880
Enzymes [BR:bsol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     FSW04_10880
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     FSW04_10880
Exosome [BR:bsol04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   FSW04_10880
  Exosomal proteins of colorectal cancer cells
   FSW04_10880
  Exosomal proteins of bladder cancer cells
   FSW04_10880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: QEC48024
UniProt: A0A5B8U4L2
Position
complement(2293168..2294568)
Genome map
AA seq 466 aa AA seqDB search
MPAARTTPTEADALVVFGITGDLARKMTFRSLYRLERRGLLTCPVVGVAFDDWTVEHLRD
HARASIAAAGERVDPKVFARLARRLSYVGGDFSAPETYARVAAALHGARLPVFYLEVPPN
LFGTVVGGLGGAGLLTAPARVVVEKPFGHDLASARALAAELHRHVDESRLLRIDHFLGKM
GLDEILYLRFANAMLEPVWNRQHVACVQITMAERFGVQDRGHFYDPVGALRDVVVNHLMQ
ILAMAAMEPPAGRDPATIDEAKLAVFRAIPDADPDRYVRGQYTGYRDIPGVSARSSTETY
AALRLEIDNWRWSGVPFLIRTGKRLPVTQTEMRVVFRHPPRLGFLPEDHRRPAPNQIVVK
IDPATGLRMVLDARGAGEPVPREIELDMDFADQGGEGPTPYEVLLAAALAGDSTHFTRQD
GVEETWRIVQPLLDAPPRLHPYAPGSWGRRPPTPSRPGSGRGRARG
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgcgcgcaccacccccaccgaggccgacgcgctcgtcgtcttcggcatcacc
ggcgacctcgcgcgcaagatgacattccgctcgctgtaccgcctggagcgccgcgggctg
ctcacctgcccggtcgtcggcgtcgcgttcgacgactggaccgtcgagcacctccgcgac
cacgcccgcgcgtcgatcgcggctgccggcgagcgcgtggaccccaaggtcttcgcccgg
ctcgcccgccggctgtcctacgtcggcggcgacttctcggcaccggagacctacgcccgc
gtcgccgcggcgcttcacggcgcgcggctgcccgtcttctacctcgaggtgcccccgaac
ctgttcgggacggtcgtcggcgggctgggcggggcggggctgctgacggcgccggcgcgg
gtggtcgtcgagaagcccttcggccatgacctggcctccgcacgggcgctggccgccgag
ctgcaccgccacgtcgacgagtcccggctgctgcgcatcgaccacttcctcgggaagatg
ggcctggacgagatcctctacctgcgcttcgccaacgcgatgctcgagccggtgtggaac
cgccagcacgtcgcgtgcgtgcagatcacgatggccgagcgcttcggcgtccaggaccgc
gggcacttctacgaccccgtcggcgccctgcgcgacgtcgtggtcaaccacctgatgcag
atcctggcgatggcggccatggagccgcccgcggggcgcgaccccgcgacgatcgacgag
gccaagctcgcggtgttccgggccatccccgacgccgaccccgaccgctacgtccgtggc
cagtacaccggctaccgcgacattccgggcgtcagcgcgcgctcgtcgaccgagacctac
gccgcgctgcgcctggagatcgacaactggcgctggagcggcgtgccgttcctcatccgc
acgggcaagcgcctgccggtcacccagaccgagatgcgcgtcgtcttccgccatccgccc
cgcctgggcttcctgccggaggaccatcgccgtccggcgccgaaccagatcgtcgtcaag
atcgatccggcgaccggcctgcgcatggtcctcgacgcccgcggcgccggcgagcccgtc
ccgcgggagatcgagctcgacatggacttcgccgaccagggcggcgaggggcccacgccc
tacgaggtcctgctcgccgccgcgctggcgggcgacagcacgcacttcacccgccaggac
ggcgtggaggagacgtggcggatcgtgcagccgctgctcgacgcgccgccccgcctgcac
ccctacgcgccgggctcctggggccgaaggccgccgacgccctcacggccgggatcgggc
cgtggcagggcccgtggctga

DBGET integrated database retrieval system