KEGG   Bacillus subtilis PY79: U712_01240Help
Entry
U712_01240        CDS       T02937                                 

Definition
(GenBank) Glutaminase 1
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp00220  Arginine biosynthesis
bsp00250  Alanine, aspartate and glutamate metabolism
bsp00471  D-Glutamine and D-glutamate metabolism
bsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsp00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    U712_01240
   00220 Arginine biosynthesis
    U712_01240
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    U712_01240
Enzymes [BR:bsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     U712_01240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AHA76202
Structure
PDB: 

Position
complement(264196..265179)
Genome map
AA seq 327 aa AA seqDB search
MKELIKEHQKDINPALQLHDWVEYYRPFAANGQSANYIPALGKVNDSQLGICVLEPDGTM
IHAGDWNVSFTMQSISKVISFIAACMSRGIPYVLDRVDVEPTGDAFNSIIRLEINKPGKP
FNPMINAGALTIASILPGESAYEKLEFLYSVMETLIGKRPRIHEEVFRSEWETAHRNRAL
AYYLKETNFLEAEVEETLEVYLKQCAMESTTEDIALIGLILAHDGYHPIRHEQVIPKDVA
KLAKALMLTCGMYNASGKYAAFVGVPAKSGVSGGIMALVPPSARREQPFQSGCGIGIYGP
AIDEYGNSLTGGMLLKHMAQEWELSIF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattgataaaagagcaccagaaagacataaacccggcgttacagcttcatgat
tgggttgaatactatcgcccttttgccgccaatggacaaagcgcaaactatatccccgct
ttaggaaaagtcaatgattcacagctcggcatctgtgtattggagcctgatggaacgatg
atacacgccggcgactggaacgtctcttttaccatgcaaagcatttcaaaagtgattagc
tttattgccgcctgcatgagccgcggcattccctatgtgcttgaccgcgtagatgtcgag
ccgacaggtgacgcctttaattcaatcattcggctcgaaatcaacaagccgggaaagccc
ttcaatcccatgatcaacgcgggtgccctcaccatcgcttcgatccttcccggagaatct
gcatacgaaaagctcgagtttctttactcggtgatggaaactttgataggaaaacggcca
agaattcatgaagaagtattccgttctgaatgggaaaccgcccaccgcaacagagcgctg
gcctactatttaaaagaaacaaactttttagaagctgaagtagaagaaacacttgaggtg
tacttgaagcaatgcgctatggagagcactacagaagatattgcgttgatcggcctgatc
cttgctcatgacgggtatcatccgattcgacacgagcaggtgattccaaaagatgtggca
aaattggccaaggcattaatgctgacgtgcggcatgtacaacgcttcaggcaaatatgcg
gcgtttgtcggcgtgccggccaaaagcggcgtctccggcggcatcatggcgctggtgcct
ccaagcgccagaagagaacagccttttcaatccggatgcggcatcggcatttacgggcct
gccattgatgaatacggcaacagcctcactggcggtatgctgctgaagcatatggcgcag
gaatgggagctcagcattttttaa

DBGET integrated database retrieval system