KEGG   Bacillus subtilis PY79: U712_03380Help
Entry
U712_03380        CDS       T02937                                 

Definition
(GenBank) Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp00970  Aminoacyl-tRNA biosynthesis
bsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    U712_03380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bsp03029]
    U712_03380
Enzymes [BR:bsp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     U712_03380
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     U712_03380
Mitochondrial biogenesis [BR:bsp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    U712_03380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AHA76626
Position
692072..693529
Genome map
AA seq 485 aa AA seqDB search
MSLFDHKITELKQLIHKKEIKISDLVDESYKRIQAVDDKVQAFLALDEERARAYAKELDE
AVDGRSEHGLLFGMPIGVKDNIVTKGLRTTCSSKILENFDPIYDATVVQRLQDAEAVTIG
KLNMDEFAMGSSTENSAYKLTKNPWNLDTVPGGSSGGSAAAVAAGEVPFSLGSDTGGSIR
QPASFCGVVGLKPTYGRVSRYGLVAFASSLDQIGPITRTVEDNAFLLQAISGVDKMDSTS
ANVDVPDFLSSLTGDIKGLKIAVPKEYLGEGVGKEARESVLAALKVLEGLGATWEEVSLP
HSKYALATYYLLSSSEASANLARFDGIRYGYRTDNADNLIDLYKQTRAEGFGNEVKRRIM
LGTFALSSGYYDAYYKKAQKVRTLIKKDFEDVFEKYDVIVGPTTPTPAFKIGENTKDPLT
MYANDILTIPVNLAGVPGISVPCGLADGLPLGLQIIGKHFDESTVYRVAHAFEQATDHHK
AKPEL
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtcattatttgatcataaaatcacagaattaaaacagctcatacataaaaaagagatt
aagatttctgatctggttgatgaatcttataaacgcatccaagcggttgatgataaggta
caagcctttttggcattagatgaagaaagagcgcgcgcatacgcgaaggagcttgatgag
gcggttgacggccgttctgagcacggtcttcttttcggtatgccgatcggcgtaaaagat
aatatcgtaacaaaagggctgcgcacaacatgctccagcaaaattctcgaaaactttgat
ccgatttacgatgctactgtcgttcagcgccttcaagacgctgaagcggtcacaatcgga
aaactgaacatggacgaattcgccatggggtcatctacagaaaactcagcttacaagctg
acgaaaaacccttggaacctggatacagttcccggcggttcaagcggcggatctgcagct
gcggttgctgcgggagaagttccgttttctcttggatctgacacaggcggctccatccgt
cagccggcatctttctgcggcgttgtcggattaaaacctacatacggacgtgtatctcgt
tacggcctggtcgcatttgcgtcttcattggaccaaatcggaccgattacacgtacggtt
gaggataacgcgtttttacttcaagcgatttccggcgtagacaaaatggactctacgagt
gcaaatgtggacgtgcctgattttctttcttcattaactggcgacatcaaaggactgaaa
atcgccgttccgaaagaataccttggtgaaggtgtcggcaaagaagcgagagaatctgtc
ttggcagcgctgaaagtccttgaaggtctcggcgctacatgggaagaagtgtctcttccg
cacagtaaatacgcgcttgcgacatattacctgctgtcatcttctgaagcgtcagcgaac
cttgcacgctttgacggcatccgctacggctaccgcacagacaacgcggataacctgatc
gacctttacaagcaaacgcgcgctgaaggtttcggaaatgaagtcaaacgccgcatcatg
ctcggaacgtttgctttaagctcaggctactacgatgcgtactacaaaaaagcgcaaaaa
gtgcgtacgttgattaagaaggatttcgaggacgtatttgaaaaatatgatgttattgtt
ggaccgactacaccgacacctgcgtttaaaatcggtgaaaacacgaaggatccgctcaca
atgtacgcaaacgatatcttaacgattccggtcaaccttgccggcgtaccgggaatcagt
gtgccatgcggattagcagacggacttccgctcggcctgcaaatcatcggaaaacacttt
gatgaaagcactgtataccgcgttgctcatgcatttgaacaagcaacagaccatcataaa
gcaaaacctgaactgtaa

DBGET integrated database retrieval system