KEGG   Bacillus subtilis PY79: U712_08870Help
Entry
U712_08870        CDS       T02937                                 

Definition
(GenBank) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp00564  Glycerophospholipid metabolism
bsp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    U712_08870
Enzymes [BR:bsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     U712_08870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-ProteinID: AHA77719
Position
1725660..1726241
Genome map
AA seq 193 aa AA seqDB search
MFNLPNKITLARIALIPIFMIIMLAPFDWGRLEVGDESIPVAHLAGAILFIIASTTDWVD
GYYARKLNLVTNFGKFLDPLADKLLVSAALIILVQFDLAPAWMVIVIISREFAVTGLRLV
LAGTGEVVAANMLGKIKTWAQIIAVSALLLHNLPFELVSFPFADLALWVAVFFTVVSGWE
YFSKNWEALKTSN
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacttaccaaataaaatcacactagctagaatcgcattaatcccaatcttcatg
attatcatgctggcgccgtttgactggggcaggctcgaagttggagacgaatccatcccg
gtcgcacatttggcgggggccattctatttattattgcatctacaacagactgggtggac
gggtattatgcccgaaaattaaatctcgtaacaaacttcgggaaatttcttgatccgctt
gcggacaaactgctcgtatccgcagcgttaattatccttgttcaatttgatctcgctcca
gcttggatggtcattgtgattatcagcagggagtttgccgtgacaggtttaaggcttgtc
ttagccggaacaggagaagtcgtagctgctaacatgcttggtaaaatcaaaacctgggca
cagattattgcggtatctgcattgcttcttcataatcttccatttgaacttgtgtcattc
ccgtttgcagacttggcgctgtgggtagccgtcttctttactgtcgtctcaggctgggaa
tatttctctaaaaattgggaagcgttaaaaacatctaactaa

DBGET integrated database retrieval system