KEGG   Bacillus subtilis PY79: U712_11780Help
Entry
U712_11780        CDS       T02937                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsp  Bacillus subtilis PY79
Pathway
bsp00071  Fatty acid degradation
bsp00072  Synthesis and degradation of ketone bodies
bsp00280  Valine, leucine and isoleucine degradation
bsp00310  Lysine degradation
bsp00362  Benzoate degradation
bsp00380  Tryptophan metabolism
bsp00620  Pyruvate metabolism
bsp00630  Glyoxylate and dicarboxylate metabolism
bsp00640  Propanoate metabolism
bsp00650  Butanoate metabolism
bsp00900  Terpenoid backbone biosynthesis
bsp01100  Metabolic pathways
bsp01110  Biosynthesis of secondary metabolites
bsp01120  Microbial metabolism in diverse environments
bsp01130  Biosynthesis of antibiotics
bsp01200  Carbon metabolism
bsp01212  Fatty acid metabolism
bsp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    U712_11780
   00630 Glyoxylate and dicarboxylate metabolism
    U712_11780
   00640 Propanoate metabolism
    U712_11780
   00650 Butanoate metabolism
    U712_11780
  09103 Lipid metabolism
   00071 Fatty acid degradation
    U712_11780
   00072 Synthesis and degradation of ketone bodies
    U712_11780
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    U712_11780
   00310 Lysine degradation
    U712_11780
   00380 Tryptophan metabolism
    U712_11780
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    U712_11780
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    U712_11780
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    U712_11780
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsp04147]
    U712_11780
Enzymes [BR:bsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     U712_11780
Exosome [BR:bsp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   U712_11780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AHA78297
Structure
PDB: 

Position
complement(2330727..2331908)
Genome map
AA seq 393 aa AA seqDB search
MRKTVIVSAARTPFGKFGGVLKEVKAAELGGIVMKEALQQAGVSGDDVEGNVMGMVVQAG
SGQIPSRQAARLAGMPWSVPSETLNKVCASGLRAVTLCDQMIRAQDADILVAGGMESMSN
IPYAVPAGRWGARMGDGELRDLMVYDGLTCAFDEVHMAVHGNTAAKEYAISRREQDEWAL
RSHARAAKAADEGKFQDEIVPVNWIGRKGKPNVVDKDEAIRRDTSLDQLAKLAPIYASDG
SITAGNAPGVNDGAGAFVLMSEEKAAELGKRPLATILGFSTTGMPAHELAAAPGFAINKL
LKKNGLTVQDIDLFEVNEAFASVVLTCEKIVGFDLEKVNVNGGAIALGHPIGASGARILM
TLVYELKRRGGGLGVAAICSGAAQGDAVLVQVH
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaacagtcattgtaagtgctgcaagaactccatttggcaaattcggcggagtt
ttgaaagaggtgaaagctgctgagcttgggggcattgtgatgaaggaggcgctgcaacag
gctggagtctctggagatgatgtagaaggaaacgtcatgggcatggttgtccaggccggc
tcagggcagataccttcccgtcaagctgcccgtctggcgggaatgccttggagtgtgccg
tcagaaacactgaataaagtctgtgcttccggccttcgcgctgtcactttatgtgatcaa
atgattcgggcgcaggatgcggacatacttgttgcgggggggatggaaagcatgagcaat
attccgtatgccgttcccgccgggcgctggggagcacggatgggggacggcgagcttagg
gacttaatggtgtatgacggattaacgtgcgcatttgacgaggtgcacatggctgttcac
ggaaatacagctgccaaggaatatgcaatctcacgaagagagcaggacgaatgggcgttg
agaagtcatgcaagggcagctaaggccgccgatgaagggaagtttcaggatgaaattgtt
cccgtcaactggatcggtcgaaaaggaaaaccaaacgttgttgataaagatgaagcgatt
cgccgtgacacaagtctggatcagctcgcaaaacttgctccgatttatgcaagtgacggt
tctatcacagccggcaatgctcctggagtcaatgacggagccggcgcgttcgtgctgatg
tctgaggaaaaagctgctgagcttggcaaacggcctctggctacaattcttggtttttca
actacgggaatgccagcgcacgagctggcggcagcgccagggtttgctattaacaagctc
ctgaaaaagaatggtttaactgtccaagatattgacttgtttgaagtaaatgaagctttt
gcttcagttgttttgacatgtgaaaaaatcgtaggtttcgatcttgaaaaagtaaatgtg
aatggcggtgcgatcgcgctcggccacccgatcggcgcgagcggtgcgagaattctcatg
acgcttgtttatgaattaaagcgacggggagggggtctgggcgttgccgctatttgcagc
ggggcagcacagggagacgccgtcttagtgcaggttcattaa

DBGET integrated database retrieval system